KEGG   Thermoplasma acidophilum: Ta1305
Entry
Ta1305            CDS       T00037                                 
Name
(GenBank) hypothetical protein
  KO
K18689  mevalonate-3-kinase [EC:2.7.1.185]
Organism
tac  Thermoplasma acidophilum
Pathway
tac00900  Terpenoid backbone biosynthesis
tac01100  Metabolic pathways
tac01110  Biosynthesis of secondary metabolites
Module
tac_M00849  C5 isoprenoid biosynthesis, mevalonate pathway, archaea
Brite
KEGG Orthology (KO) [BR:tac00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ta1305
Enzymes [BR:tac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.185  mevalonate 3-kinase
     Ta1305
SSDB
Motif
Pfam: SbmA_BacA
Other DBs
NCBI-ProteinID: CAC12426
UniProt: Q9HIN1
Structure
LinkDB
Position
1352081..1353037
AA seq 318 aa
MTYRSIGSTAYPTIGVVLLGGIANPVTRTPLHTSAGIAYSDSCGSIRSETRIYADEATHI
YFNGTESTDDNRSVRRVLDRYSSVFEEAFGTKTVSYSSQNFGILSGSSDAGAASIGAAIL
GLKPDLDPHDVENDLRAVSESAGRSLFGGLTITWSDGFHAYTEKILDPEAFSGYSIVAFA
FDYQRNPSDVIHQNIVRSDLYPARKKHADEHAHMIKEYAKTNDIKGIFDLAQEDTEEYHS
ILRGVGVNVIRENMQKLISYLKLIRKDYWNAYIVTGGSNVYVAVESENADRLFSIENTFG
SKKKMLRIVGGAWHRRPE
NT seq 957 nt   +upstreamnt  +downstreamnt
atgacctacagatcaataggatcaactgcttatccaacgatcggcgttgttctcctgggc
gggatagcaaatcccgtcacgaggacgccgctgcatacctcggcagggatagcatacagt
gattcctgcggatcgataagatccgagaccaggatatacgccgatgaggctacgcacata
tatttcaatggtacggaatcgacagatgacaatagatccgtgaggcgtgtgcttgatcgt
tattcaagcgtcttcgaggaggcgttcggtacgaagactgtttcatattcttcacagaac
ttcggcatactgagcggcagttccgatgctggagcggcatcgataggcgcagctatattg
ggcctcaaacccgatctggatccgcacgatgttgaaaatgacctcagggcggtctccgaa
agcgcaggcaggagcctcttcggcggcttaacaataacttggagcgatggtttccatgca
tatacggaaaagattcttgatcctgaggcattctccgggtattcgatcgttgccttcgcg
tttgactatcagagaaatccgtccgatgtcatacaccagaatatagtgagaagcgatctc
tatccggccaggaagaagcatgccgatgaacatgcgcacatgatcaaggagtacgcaaag
acaaacgacataaagggcatatttgatctggcccaggaagatacagaggaataccattcc
atacttcgtggcgtgggcgtgaacgtgataagggagaacatgcagaagctcatcagttac
ctgaagctgatcaggaaggattactggaatgcctacatcgtgaccggcggaagcaacgtc
tacgtggctgtagaaagcgagaatgcagataggctgttttcgatcgaaaataccttcggt
tcaaaaaagaagatgctcaggatagttggcggtgcctggcatagaagaccagagtga

DBGET integrated database retrieval system