Thalassomonas actiniarum: SG35_001420 Help Entry SG35_001420       CDS       T08826                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tact  Thalassomonas actiniarum Pathway tact00998   Biosynthesis of various antibiotics tact01100   Metabolic pathways tact01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tact00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SG35_001420    00074 Mycolic acid biosynthesis     SG35_001420   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SG35_001420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  WDD99377 UniProt:  A0AAE9YTT5 LinkDB All DBs Position 306692..306952 Genome browser AA seq 86 aa AA seqDB search MREIKQELETILREYTAAELKSLSGDENLADIGIDSLSLVEIIFDIEEQFDIKVPHEAEL EQRGFSLDSLADLLHLVTCLYQERQS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaaattaaacaagagctggagaccatcttaagggaatacacagccgcagagcta aagtccttgtccggggatgaaaacctggcggatatcggaatcgactccctgtcgctggtg gagatcatttttgatattgaagagcagtttgatatcaaggttccccatgaagccgagctg gaacagcggggattttcccttgattccctggcggacttactgcatttagtcacttgcctg tatcaggagcggcaaagctga

DBGET integrated database retrieval system