Thalassomonas actiniarum: SG35_002105 Help Entry SG35_002105       CDS       T08826                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism tact  Thalassomonas actiniarum Brite KEGG Orthology (KO) [BR:tact00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tact03110]     SG35_002105 (grxC) Chaperones and folding catalysts [BR:tact03110]  Protein folding catalysts   Protein disulfide isomerase    SG35_002105 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 GST_N_2 SH3BGR Thioredoxin_3 DSBA Motif Other DBs NCBI-ProteinID:  WDD99498 UniProt:  A0AAE9YSI7 LinkDB All DBs Position 465226..465483 Genome browser AA seq 85 aa AA seqDB search MVAVDIYTKEYCPYCVRAKALLTQKQVSFREIKIDENPGLRPEMIERSKGGTTVPQIFIN DAHVGGCDDLMALEASNNLDSLLKA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtggtagcggtagatatttatactaaagagtattgtccttattgcgtcagggccaaggcc ttgctgacgcaaaaacaagtcagtttcagagaaataaaaatcgacgaaaatccgggatta agacccgagatgattgagcgcagcaagggcggtactacggtaccacagatctttattaac gatgcccatgtcggcggttgtgacgatttaatggcattagaagccagtaataacttagac agcctgctaaaggcataa

DBGET integrated database retrieval system