Thalassomonas actiniarum: SG35_009180 Help Entry SG35_009180       CDS       T08826                                  Name (GenBank) glutaredoxin family protein   KO K03676   glutaredoxin 3 Organism tact  Thalassomonas actiniarum Brite KEGG Orthology (KO) [BR:tact00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tact03110]     SG35_009180 Chaperones and folding catalysts [BR:tact03110]  Protein folding catalysts   Protein disulfide isomerase    SG35_009180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 Motif Other DBs NCBI-ProteinID:  WDE00781 UniProt:  A0AAF0C568 LinkDB All DBs Position 2127841..2128086 Genome browser AA seq 81 aa AA seqDB search MSKIEIYTRPGCGYCTHAKRLLAGQGLSFVEYDVYQHPQYLARMQLRTPGNTYPQILIND VAIGGFSELLAMQESKLLPGC NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcaaaattgaaatttatacccggcccggatgcggttattgcactcatgccaagcgg ttgttggcgggacaagggctaagttttgtcgaatatgacgtctatcagcatccccaatac ctggcccggatgcagctgcgtaccccgggcaacacttatccccagatattgataaacgat gtcgccatcggggggtttagcgaattactggccatgcaggaaagcaagttactgccgggc tgctag

DBGET integrated database retrieval system