Thalassomonas actiniarum: SG35_016785 Help Entry SG35_016785       CDS       T08826                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tact  Thalassomonas actiniarum Pathway tact00998   Biosynthesis of various antibiotics tact01100   Metabolic pathways tact01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tact00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SG35_016785 (acpP)    00074 Mycolic acid biosynthesis     SG35_016785 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SG35_016785 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  WDD97008 UniProt:  A0AAE9YMI5 LinkDB All DBs Position complement(3862131..3862364) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKITVEQLGVSEAEVKTESSFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVTANQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtacaatcgaagaacgcgtaaaaaaaataactgttgaacaactgggtgtgagtgaa gcagaagtaaaaactgaatcatctttcgttgatgatttaggcgccgactcacttgacaca gttgagttagtaatggcgttagaagaagaattcgacacagaaattcctgatgaagaagct gaaaaaatcactacagttcaagctgccatcgactacgttactgcaaaccagtaa

DBGET integrated database retrieval system