KEGG   Tachyglossus aculeatus (Australian echidna): 119920928
Entry
119920928         CDS       T10703                                 
Name
(RefSeq) calmodulin-A-like
  KO
K02183  calmodulin
Organism
tacu  Tachyglossus aculeatus (Australian echidna)
Pathway
tacu04014  Ras signaling pathway
tacu04015  Rap1 signaling pathway
tacu04020  Calcium signaling pathway
tacu04022  cGMP-PKG signaling pathway
tacu04024  cAMP signaling pathway
tacu04070  Phosphatidylinositol signaling system
tacu04114  Oocyte meiosis
tacu04218  Cellular senescence
tacu04261  Adrenergic signaling in cardiomyocytes
tacu04270  Vascular smooth muscle contraction
tacu04371  Apelin signaling pathway
tacu04625  C-type lectin receptor signaling pathway
tacu04713  Circadian entrainment
tacu04720  Long-term potentiation
tacu04722  Neurotrophin signaling pathway
tacu04728  Dopaminergic synapse
tacu04740  Olfactory transduction
tacu04744  Phototransduction
tacu04750  Inflammatory mediator regulation of TRP channels
tacu04910  Insulin signaling pathway
tacu04912  GnRH signaling pathway
tacu04915  Estrogen signaling pathway
tacu04916  Melanogenesis
tacu04921  Oxytocin signaling pathway
tacu04922  Glucagon signaling pathway
tacu04924  Renin secretion
tacu04925  Aldosterone synthesis and secretion
tacu04970  Salivary secretion
tacu04971  Gastric acid secretion
tacu05010  Alzheimer disease
tacu05012  Parkinson disease
tacu05022  Pathways of neurodegeneration - multiple diseases
tacu05031  Amphetamine addiction
tacu05034  Alcoholism
tacu05133  Pertussis
tacu05152  Tuberculosis
tacu05163  Human cytomegalovirus infection
tacu05167  Kaposi sarcoma-associated herpesvirus infection
tacu05170  Human immunodeficiency virus 1 infection
tacu05200  Pathways in cancer
tacu05214  Glioma
tacu05417  Lipid and atherosclerosis
tacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    119920928
   04015 Rap1 signaling pathway
    119920928
   04371 Apelin signaling pathway
    119920928
   04020 Calcium signaling pathway
    119920928
   04070 Phosphatidylinositol signaling system
    119920928
   04024 cAMP signaling pathway
    119920928
   04022 cGMP-PKG signaling pathway
    119920928
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    119920928
   04218 Cellular senescence
    119920928
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    119920928
  09152 Endocrine system
   04910 Insulin signaling pathway
    119920928
   04922 Glucagon signaling pathway
    119920928
   04912 GnRH signaling pathway
    119920928
   04915 Estrogen signaling pathway
    119920928
   04921 Oxytocin signaling pathway
    119920928
   04916 Melanogenesis
    119920928
   04924 Renin secretion
    119920928
   04925 Aldosterone synthesis and secretion
    119920928
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    119920928
   04270 Vascular smooth muscle contraction
    119920928
  09154 Digestive system
   04970 Salivary secretion
    119920928
   04971 Gastric acid secretion
    119920928
  09156 Nervous system
   04728 Dopaminergic synapse
    119920928
   04720 Long-term potentiation
    119920928
   04722 Neurotrophin signaling pathway
    119920928
  09157 Sensory system
   04744 Phototransduction
    119920928
   04740 Olfactory transduction
    119920928
   04750 Inflammatory mediator regulation of TRP channels
    119920928
  09159 Environmental adaptation
   04713 Circadian entrainment
    119920928
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119920928
  09162 Cancer: specific types
   05214 Glioma
    119920928
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    119920928
   05163 Human cytomegalovirus infection
    119920928
   05167 Kaposi sarcoma-associated herpesvirus infection
    119920928
  09171 Infectious disease: bacterial
   05133 Pertussis
    119920928
   05152 Tuberculosis
    119920928
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    119920928
   05012 Parkinson disease
    119920928
   05022 Pathways of neurodegeneration - multiple diseases
    119920928
  09165 Substance dependence
   05031 Amphetamine addiction
    119920928
   05034 Alcoholism
    119920928
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    119920928
   05418 Fluid shear stress and atherosclerosis
    119920928
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tacu01009]
    119920928
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tacu04131]
    119920928
   03036 Chromosome and associated proteins [BR:tacu03036]
    119920928
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tacu04147]
    119920928
Protein phosphatases and associated proteins [BR:tacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     119920928
Membrane trafficking [BR:tacu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    119920928
Chromosome and associated proteins [BR:tacu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     119920928
Exosome [BR:tacu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   119920928
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 Allatotropin-like_C EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 EFhand_Ca_insen SAPC2_N TerB EF-hand_EFHB_C EF-hand_STIM1 DUF1103 BamM_C Dockerin_1 DUF5580_M Caleosin FCaBP_EF-hand SurA_N_3 Fe_hyd_lg_C RFC1 GPHH
Other DBs
NCBI-GeneID: 119920928
NCBI-ProteinID: XP_038597087
LinkDB
Position
12:complement(15755055..15755836)
AA seq 149 aa
MTDQLSEEQIAEFKEAFSLFDKDADGTITTKELGTVMRSLGQNPTEAELQDMINEIDADG
NGTVDFPEFLGMMARKMKDTDSEEEIREAFRVFDKDGNGYVSAAELRHVMTRLGEKLTDE
EVDEMIREADTDGDGQVNYEEFVRMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atgactgaccagctgtctgaggagcagatcgccgaattcaaggaggctttctcgctgttc
gacaaggatgctgacggcaccatcaccaccaaggaactgggcactgtcatgcggtccctg
gggcagaaccccaccgaggcggagctccaggacatgatcaacgagatcgatgccgacggc
aatggcacggtcgacttccccgagttcctgggcatgatggcgcggaagatgaaggacacg
gacagcgaggaggagatccgtgaagccttccgggtgtttgacaaggatggcaacggctac
gtcagcgctgccgagctgcggcatgtgatgaccaggctgggggagaagctgacggatgag
gaggtggacgagatgatccgggaggccgatacggacggagacggccaggtgaactacgag
gagttcgtccgcatgctggtctccaagtga

DBGET integrated database retrieval system