Tachyglossus aculeatus (Australian echidna): 119932279
Help
Entry
119932279 CDS
T10703
Symbol
XRCC3
Name
(RefSeq) DNA repair protein XRCC3
KO
K10880
DNA-repair protein XRCC3
Organism
tacu Tachyglossus aculeatus (Australian echidna)
Pathway
tacu03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
tacu00001
]
09120 Genetic Information Processing
09124 Replication and repair
03440 Homologous recombination
119932279 (XRCC3)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
tacu03400
]
119932279 (XRCC3)
DNA repair and recombination proteins [BR:
tacu03400
]
Eukaryotic type
DSBR (double strand breaks repair)
HR (homologous recombination)
RecA family proteins
119932279 (XRCC3)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Rad51
AAA_25
DnaB_C
ATPase
RecA
RNA_pol_A_CTD
Motif
Other DBs
NCBI-GeneID:
119932279
NCBI-ProteinID:
XP_038607308
LinkDB
All DBs
Position
1:145085711..145149102
Genome browser
AA seq
399 aa
AA seq
DB search
MDWDQLELNPKVIAAVKKAQIHSVREVLNLSGPDLQRLTKLSSLDVQRLLKTVALALRRN
TVVTALHMYQQRAKFPAQHQKLSLGCPVLDGLLGGGLPLAGITELAGRSSAGKTQLGMQL
CLSVQYPPLYGGLGAGAVYICTEDVFPNKRLQQLIAQQQELRADVPGEVMERMKFGNNIF
IEHAADLETLQDCVGKRVPILLARGLARLVIIDSIAALFRCEFGARDSVGRAKCLQTLGA
KLHRLSAEFDSPVLCINQVTDTLDERGTAHGNFSLEEEAVIPALGLTWSNQLLMRMMVHR
LPAGSEPTEAAAAAGISAPGPVVRALRVVFAPHLPPAFCYFTVNAEGVKGLKEVPSIPPF
LQKAPYQEARLLPDGLAQANGARPATPRSAAPEPQPSLG
NT seq
1200 nt
NT seq
+upstream
nt +downstream
nt
atggattgggaccagttggaactgaatcccaaagtgattgccgctgttaagaaagcccag
atacattcagtgagggaagttttgaatctttctggcccagacttgcagaggctgacaaag
ctctccagcctcgacgtccagcgtttattaaaaactgtggctttagcactcaggaggaac
accgtggtcacagcgcttcacatgtatcagcagagagcgaaattcccggcccagcaccag
aaactcagcttgggctgcccggtcctggacgggctgttgggcggcggcctgcccctggcc
gggataacggagctggcgggacggagctcggctgggaagacgcagctcggcatgcagctg
tgcctgtccgtgcaataccctcccctgtacggggggctgggggcaggagccgtctatatc
tgtaccgaggacgtgttcccgaacaagcggctgcagcagctgatagcccagcagcaggag
ctgagggccgatgtccccggcgaggtcatggagcggatgaaatttggcaataacatcttc
atcgagcacgccgcggacctggagaccctgcaggactgcgtggggaagcgggtgcccatc
ctgctggcacggggcctggcccgcctggtgatcatcgactccatcgcggcgctcttccgc
tgcgagttcggggcccgcgactcggtcggccgggccaagtgtctgcagacgctcggggcc
aagctgcaccggctcagcgccgagttcgacagccccgtcctgtgcatcaaccaggtcacc
gacaccttggatgaaagagggacggctcacggtaatttcagcttggaggaagaggccgtc
atcccagctctcggtctgacctggtccaaccaactgctgatgcggatgatggtccaccgc
ctccctgccgggagcgagccgaccgaagccgccgccgccgcgggcatctcggccccgggc
cccgtggtgcgggcactccgggtcgtcttcgctcctcacctgcccccagccttttgctac
ttcacggtgaacgccgagggcgtgaaaggattaaaggaagtcccatccatccctcccttc
cttcagaaagccccgtaccaggaagcgcgactcctcccggatggactggcacaggccaac
ggggcccgtccggccacccctcgctcggcagccccggaaccacaaccgtctttaggctga
DBGET
integrated database retrieval system