KEGG   Tachyglossus aculeatus (Australian echidna): 119950275
Entry
119950275         CDS       T10703                                 
Symbol
SKP1
Name
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
tacu  Tachyglossus aculeatus (Australian echidna)
Pathway
tacu03083  Polycomb repressive complex
tacu04110  Cell cycle
tacu04114  Oocyte meiosis
tacu04120  Ubiquitin mediated proteolysis
tacu04141  Protein processing in endoplasmic reticulum
tacu04310  Wnt signaling pathway
tacu04350  TGF-beta signaling pathway
tacu04710  Circadian rhythm
tacu05132  Salmonella infection
tacu05170  Human immunodeficiency virus 1 infection
tacu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:tacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    119950275 (SKP1)
   04120 Ubiquitin mediated proteolysis
    119950275 (SKP1)
  09126 Chromosome
   03083 Polycomb repressive complex
    119950275 (SKP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    119950275 (SKP1)
   04350 TGF-beta signaling pathway
    119950275 (SKP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    119950275 (SKP1)
   04114 Oocyte meiosis
    119950275 (SKP1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    119950275 (SKP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119950275 (SKP1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    119950275 (SKP1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    119950275 (SKP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tacu04131]
    119950275 (SKP1)
   04121 Ubiquitin system [BR:tacu04121]
    119950275 (SKP1)
   03036 Chromosome and associated proteins [BR:tacu03036]
    119950275 (SKP1)
Membrane trafficking [BR:tacu04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    119950275 (SKP1)
Ubiquitin system [BR:tacu04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     119950275 (SKP1)
   Cul7 complex
     119950275 (SKP1)
Chromosome and associated proteins [BR:tacu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     119950275 (SKP1)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     119950275 (SKP1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 119950275
NCBI-ProteinID: XP_038628450
LinkDB
Position
X1:complement(48775524..48792516)
AA seq 163 aa
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgccttcgattaaactgcaaagttctgatggagagatattcgaagttgatgtggaaatt
gcaaaacagtctgtcactatcaagactatgttagaagatttgggcatggacgacgaagga
gatgatgacccggtccctctgccgaatgtcaacgcagcaatattgaaaaaggtcatccag
tggtgtacccatcacaaggacgatccccccccacccgaggacgacgagaacaaagagaag
cgaacggatgatatccctgtgtgggaccaagagttcctgaaagtggaccaaggaaccctc
tttgaactcattctggctgcaaactatttagacatcaaaggtttgcttgatgtgacgtgc
aagactgttgcaaatatgattaaggggaaaaccccagaagagattcgcaagacattcaat
atcaagaatgactttactgaagaggaagaagcacaggtacgcaaagagaaccagtggtgt
gaagagaagtga

DBGET integrated database retrieval system