Trichoplax adhaerens (placozoan): TRIADDRAFT_18503 Help Entry TRIADDRAFT_18503  CDS       T01069                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism tad  Trichoplax adhaerens (placozoan) Pathway tad03020   RNA polymerase tad03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tad00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     TRIADDRAFT_18503   09124 Replication and repair    03420 Nucleotide excision repair     TRIADDRAFT_18503  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tad03021]     TRIADDRAFT_18503    03400 DNA repair and recombination proteins [BR:tad03400]     TRIADDRAFT_18503 Transcription machinery [BR:tad03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      TRIADDRAFT_18503   RNA polymerase III system    RNA polymerase III      TRIADDRAFT_18503   RNA polymerase I system    RNA polymerase I      TRIADDRAFT_18503 DNA repair and recombination proteins [BR:tad03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       TRIADDRAFT_18503 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  6750148 NCBI-ProteinID:  XP_002108199 JGI:  18503 UniProt:  B3RID1 LinkDB All DBs AA seq 67 aa AA seqDB search MIIPIRCFTCGKVIGNKWEAYLHLLQAEYTEGDALDALGLKRYCCRRMLLSHVDLIEKLL NYTPLEK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgatcattccaattagatgttttacctgcggcaaggtgataggcaataaatgggaagcg taccttcatcttttacaagctgaatacacagaaggagatgctttggatgctttaggccta aaaagatattgctgtagacgaatgcttttgtctcacgtggatctgatagagaaattacta aactatacacctttggagaagtaa

DBGET integrated database retrieval system