Trichoplax adhaerens (placozoan): TRIADDRAFT_30732 Help Entry TRIADDRAFT_30732  CDS       T01069                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism tad  Trichoplax adhaerens (placozoan) Pathway tad03022   Basal transcription factors tad03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tad00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     TRIADDRAFT_30732   09124 Replication and repair    03420 Nucleotide excision repair     TRIADDRAFT_30732  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tad03021]     TRIADDRAFT_30732    03400 DNA repair and recombination proteins [BR:tad03400]     TRIADDRAFT_30732 Transcription machinery [BR:tad03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      TRIADDRAFT_30732 DNA repair and recombination proteins [BR:tad03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      TRIADDRAFT_30732 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  6757479 NCBI-ProteinID:  XP_002116172 JGI:  30732 UniProt:  B3S7I9 LinkDB All DBs AA seq 75 aa AA seqDB search MVNVLKGVLVECDPTVKQYLLHLDETNALGQKFVIEDLDDQHVFVTAEIKDTLMKKIDAM MEQLSYSSSDKQETK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggtaaacgtcttgaagggagtgttggttgaatgtgatccaacggtgaaacagtactta ctgcacctggacgaaaccaatgcccttggtcaaaaattcgttattgaagatttagatgat caacatgtatttgtcacagcggagatcaaagatacgttaatgaagaagattgatgctatg atggagcagttatcttactcctcgagcgataagcaagaaaccaagtag

DBGET integrated database retrieval system