Trichoplax adhaerens (placozoan): TRIADDRAFT_33247 Help Entry TRIADDRAFT_33247  CDS       T01069                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tad  Trichoplax adhaerens (placozoan) Pathway tad03010   Ribosome tad04120   Ubiquitin mediated proteolysis tad04137   Mitophagy - animal tad04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:tad00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TRIADDRAFT_33247   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TRIADDRAFT_33247  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     TRIADDRAFT_33247    04137 Mitophagy - animal     TRIADDRAFT_33247  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tad03011]     TRIADDRAFT_33247    04121 Ubiquitin system [BR:tad04121]     TRIADDRAFT_33247 Ribosome [BR:tad03011]  Ribosomal proteins   Eukaryotes    Large subunit     TRIADDRAFT_33247   Archaea     TRIADDRAFT_33247 Ubiquitin system [BR:tad04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TRIADDRAFT_33247 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rv3651-like_C pAdhesive_8 Motif Other DBs NCBI-GeneID:  6759156 NCBI-ProteinID:  XP_002117922 JGI:  33247 UniProt:  B3SCG2 LinkDB All DBs AA seq 76 aa AA seqDB search MFIYIKTSMGKLTRLIVDPSDTIEMVKMKYEFEVGIPSGKQRLVFGGLRLEDEHTLAYYG IQNGKIGHVSSPIEVE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgttcatctacattaaaacctctatggggaaattaacgaggttaattgtagaccctagt gatactatcgaaatggtcaaaatgaaatacgaatttgaagtaggaataccttcaggtaag caacgtctagtctttggtggattacgcctagaagatgagcatactttagcatattatggt atccagaacggtaagattgggcatgtttcatctccaatagaagtggaatag

DBGET integrated database retrieval system