Trichoplax adhaerens (placozoan): TRIADDRAFT_35611 Help Entry TRIADDRAFT_35611  CDS       T01069                                  Name (RefSeq) expressed hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism tad  Trichoplax adhaerens (placozoan) Pathway tad03060   Protein export tad04141   Protein processing in endoplasmic reticulum tad04145   Phagosome Brite KEGG Orthology (KO) [BR:tad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TRIADDRAFT_35611    04141 Protein processing in endoplasmic reticulum     TRIADDRAFT_35611  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     TRIADDRAFT_35611  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tad04131]     TRIADDRAFT_35611   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tad02044]     TRIADDRAFT_35611 Membrane trafficking [BR:tad04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     TRIADDRAFT_35611 Secretion system [BR:tad02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    TRIADDRAFT_35611 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  6751540 NCBI-ProteinID:  XP_002110856 JGI:  35611 UniProt:  B3RRE1 LinkDB All DBs AA seq 95 aa AA seqDB search MPTSPSSTSVGSGRAAAGGKSPVKGASGVRQRKPTGGGAGGAAPRVGSAGAATSWRFFTE DSPGFKVEPVPVLVMSIIYIVAIFLLHLWGKYSRG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcctacttcgccttcttctacttccgttgggtctgggagagctgctgctggtggaaag tcaccggtcaagggtgcaagtggagtacgccaaagaaaacctaccggtggtggtgccggc ggtgctgctccaagagttggttctgcaggtgcagcgacatcgtggagatttttcacggaa gattctccaggatttaaagtagagcctgtgccagttttagtcatgagtatcatatacatt gttgctattttcttactccatttatggggaaagtattctcgtggataa

DBGET integrated database retrieval system