Trichoplax adhaerens (placozoan): TRIADDRAFT_55150 Help Entry TRIADDRAFT_55150  CDS       T01069                                  Name (RefSeq) hypothetical protein   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism tad  Trichoplax adhaerens (placozoan) Pathway tad03018   RNA degradation tad03040   Spliceosome Brite KEGG Orthology (KO) [BR:tad00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     TRIADDRAFT_55150   09123 Folding, sorting and degradation    03018 RNA degradation     TRIADDRAFT_55150  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tad03019]     TRIADDRAFT_55150    03041 Spliceosome [BR:tad03041]     TRIADDRAFT_55150 Messenger RNA biogenesis [BR:tad03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      TRIADDRAFT_55150   mRNA degradation factors    5'-3' decay     Lsm complex      TRIADDRAFT_55150 Spliceosome [BR:tad03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     TRIADDRAFT_55150 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF150_C Motif Other DBs NCBI-GeneID:  6752984 NCBI-ProteinID:  XP_002111312 JGI:  55150 UniProt:  B3RU44 LinkDB All DBs AA seq 102 aa AA seqDB search MTGPPEKKKRESIVDLQKHIDKKVRVKFQGGREAIGILKGYDPLLNLVLDNAVENLRDFE DLSRISNETRQLGLVVCRGTSVVVISPNDGIEEIANPFVQAE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgacaggacctccggagaaaaagaaaagagagagtatcgttgatctgcaaaagcatatc gataagaaagttcgcgttaaatttcaaggtggccgagaagctataggcattctgaaaggt tatgatccgttattgaacttggtacttgataatgctgtagaaaatttacgtgatttcgaa gatttatcacgaattagtaacgaaacaagacaattaggattagtggtttgtcgaggcact tctgtagtagtgattagccctaatgacggtatcgaagagattgccaatccattcgtccaa gcagagtga

DBGET integrated database retrieval system