Trichoplax adhaerens (placozoan): TRIADDRAFT_63141 Help Entry TRIADDRAFT_63141  CDS       T01069                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism tad  Trichoplax adhaerens (placozoan) Pathway tad03060   Protein export tad04141   Protein processing in endoplasmic reticulum tad04145   Phagosome Brite KEGG Orthology (KO) [BR:tad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TRIADDRAFT_63141    04141 Protein processing in endoplasmic reticulum     TRIADDRAFT_63141  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     TRIADDRAFT_63141  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tad04131]     TRIADDRAFT_63141   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tad02044]     TRIADDRAFT_63141 Membrane trafficking [BR:tad04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     TRIADDRAFT_63141 Secretion system [BR:tad02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    TRIADDRAFT_63141 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  6757826 NCBI-ProteinID:  XP_002116543 JGI:  63141 UniProt:  B3S8K3 LinkDB All DBs AA seq 68 aa AA seqDB search MDQVTTLVDPLKVFVKDSVRLVKRCTKPDRKEFQKIAFATAIGFGIMGFIGFFVKLIHIP INNIIVGS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggaccaagtaacgactttagttgacccactaaaagtgtttgtaaaggattctgttcgt ttagtcaaacgatgcactaaacctgaccgaaaagaatttcaaaagattgcatttgccacg gctatcggttttggaattatgggatttataggctttttcgttaagttgatccacatcccc atcaataacatcatcgttggaagttaa

DBGET integrated database retrieval system