Trichoplax adhaerens (placozoan): TRIADDRAFT_63627 Help Entry TRIADDRAFT_63627  CDS       T01069                                  Name (RefSeq) expressed hypothetical protein   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism tad  Trichoplax adhaerens (placozoan) Pathway tad00480   Glutathione metabolism tad00980   Metabolism of xenobiotics by cytochrome P450 tad00982   Drug metabolism - cytochrome P450 tad00983   Drug metabolism - other enzymes tad01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:tad00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     TRIADDRAFT_63627   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     TRIADDRAFT_63627    00982 Drug metabolism - cytochrome P450     TRIADDRAFT_63627    00983 Drug metabolism - other enzymes     TRIADDRAFT_63627  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tad02000]     TRIADDRAFT_63627 Enzymes [BR:tad01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      TRIADDRAFT_63627 Transporters [BR:tad02000]  Other transporters   Pores ion channels [TC:1]    TRIADDRAFT_63627 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MAPEG DUF3413 Motif Other DBs NCBI-GeneID:  6751048 NCBI-ProteinID:  XP_002109264 JGI:  63627 UniProt:  B3RNC7 LinkDB All DBs AA seq 148 aa AA seqDB search MVVASKLVFDNPVFSMFAFHSSVLVAKMLLVTLRTSLARIASKCFSNDEDIQAFTDGNNT KAVGHGSGDEFVERCRRAHLNDLENILPFLAVGLLYVLTNPTPKAAGCHFRIFTAVSEMM AFFSLIILCLPEVELTIVHFVRGLNCTK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggttgtagcttcgaaattagtcttcgataatccagtattttctatgtttgcttttcat tcgagtgtgcttgttgctaaaatgctattggtgactctgagaacatcactagctcgaatt gcatctaagtgcttctcaaatgacgaagatatacaagcttttacggatggaaataatact aaagccgtaggacatggctctggagatgaatttgtggaaagatgtagaagggcccatttg aacgatctggagaacattcttcctttcttggccgtaggtttgctttacgtccttaccaac ccgacgccaaaagctgcaggttgtcattttcgcatcttcactgcggtaagcgaaatgatg gcgtttttctctctaattatattatgcttgcctgaagtagaacttacgatcgttcatttt gtacgaggtcttaattgcacaaaataa

DBGET integrated database retrieval system