KEGG   Tichowtungia aerotolerans: GT409_01275
Entry
GT409_01275       CDS       T07773                                 
Symbol
sulP
Name
(GenBank) sulfate permease
  KO
K03321  sulfate permease, SulP family
Organism
taer  Tichowtungia aerotolerans
Brite
KEGG Orthology (KO) [BR:taer00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:taer02000]
    GT409_01275 (sulP)
Transporters [BR:taer02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   GT409_01275 (sulP)
SSDB
Motif
Pfam: Sulfate_transp STAS STAS_2
Other DBs
NCBI-ProteinID: QHI68134
UniProt: A0A6P1M6A3
LinkDB
Position
complement(324943..326598)
AA seq 551 aa
MLKPKLFSILNEYNRTVFRSDLIAGVTVGIVAVPLAMAFAIAAGLPPERGLFTAVVAGFL
ISVLGGSRVQIGGPTGAFVVIVSGIVAQHGYAGLATATAMAGLMLVAMGLGRMGGLIRFI
PFPVVTGFTSGIAVVIFSTQIKDLFGLQVDALPADFIAKWATYIRHFDTVQMPAAAIGVG
TILLVVGVRRLLPRWPALLIGMVAATLVSSGLGLDVETIGSRFGDLPRTLPAPSWVGVSF
GEIKALMGPAFTIAILCAIESLLSATVADGMTGGRHRSNMELVAQGAANIGSALFGGIPA
TGAIARTATNIKSGGKTPVAGMIHAVTLALVLLFFAPVARMIPLAALAGILVVVSAGMSE
AGRFVRLLKSPRSDVLVLLTTFFLTVLIDLTVAVEVGIVLAALLFIRRMADVGGVREITA
GLYDDPDGEESGWLDRVKNLPAGVVVYEVQGPFFFGAADRYRQLIQSKEKSTRVIILRMR
HVPAIDATGHNVLLDLHKQCSKKNMQLVFSGVRPQPMDVFRQTGFLAEVGPENVCRSIDE
ALVRMNEVLGR
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgctcaagcccaagctgttttccattctcaacgaatacaaccgtacagtttttcgcagt
gacctgattgcgggcgtcacggtgggaattgttgcggtgcctctggcgatggcgtttgcc
atcgccgcaggactgcctccggagcggggcctctttacggcggtcgtcgccgggtttttg
atatccgttctcggaggaagccgcgtgcagattggcgggccgaccggcgctttcgtggtg
attgtctccggcatcgtcgctcagcacggctatgccggcctggcgacggcaaccgccatg
gcgggcctgatgctggtcgccatggggcttgggcgcatgggtggtttgatccgttttatt
ccatttccggtcgttaccggcttcacatctggaatcgccgttgtgattttctccactcag
attaaagacttgtttgggctgcaggtggatgctcttccggctgattttattgcgaagtgg
gcgacttatattcggcatttcgacactgttcagatgcccgctgcagcaatcggagtggga
acaatcctgctggtggtgggagtccgccggttgcttcctcgctggcccgcgctgttgatc
ggcatggtcgccgcgacgctggtttccagcgggttggggttggatgttgaaaccatcggc
agtcggttcggcgatcttcctcgtaccttgccggcgccgtcgtgggtgggtgtgtctttt
ggtgaaatcaaagctctgatggggccggcgtttacgatagcaatcctttgtgcaattgag
tctctcctttcggccaccgtcgccgacgggatgaccggggggaggcaccgctctaatatg
gagctggtggcgcagggggcggcgaacatcgggtctgcactgtttggcggaattccggcc
accggtgccattgcacgtacggcgaccaatattaaaagtggcgggaaaaccccggtcgcc
ggaatgattcatgccgtgacgcttgcgctggtcctgctcttttttgcgccggtggcccga
atgatcccgctggcggcccttgcaggaattctcgtcgtggtcagcgctgggatgagtgag
gccgggcgctttgtgcggctgctgaagtctcctcgaagcgatgtgctggtgctgctgacc
acgttcttcctgacggttttgattgatctgacagtcgcggttgaagtcggaattgtcctg
gcagcgctgctctttattcgccgtatggcagatgtcggaggggtccgtgaaattaccgcc
gggctctacgacgatcccgatggcgaagaaagcggttggctggatcgagttaaaaatctc
ccggccggcgttgtggtttatgaagttcagggaccgtttttcttcggtgcggctgaccgg
taccgtcagctgatccagtcaaaagaaaaatcaacccgggttattattctgagaatgcgg
catgttccggccattgatgccacagggcacaatgtgctccttgatctacataaacaatgc
agtaagaaaaatatgcagctggtcttttcgggtgtgcggcctcagcctatggatgtgttt
cggcagaccgggtttctggctgaagtcggtccggaaaacgtctgccgctccattgatgaa
gcgcttgttcgaatgaatgaggttctcggacggtaa

DBGET integrated database retrieval system