Tichowtungia aerotolerans: GT409_08440 Help Entry GT409_08440       CDS       T07773                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism taer  Tichowtungia aerotolerans Brite KEGG Orthology (KO) [BR:taer00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:taer03032]     GT409_08440    03036 Chromosome and associated proteins [BR:taer03036]     GT409_08440    03400 DNA repair and recombination proteins [BR:taer03400]     GT409_08440 DNA replication proteins [BR:taer03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GT409_08440 Chromosome and associated proteins [BR:taer03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GT409_08440 DNA repair and recombination proteins [BR:taer03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GT409_08440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding PqqD HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QHI69481 UniProt:  A0A6P1M6K1 LinkDB All DBs Position 2071545..2071826 Genome browser AA seq 93 aa AA seqDB search MAKAATKSQIIAQIAEDAEISKVQAKAAVESLVAQAYKGAKDGFTIPGVGKLVKVKRKAR MGRNPATGETIKIPAKTVLKFRIAKAAKDAILG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagcagcaaccaagtcacagatcatcgctcaaatcgctgaagatgcagagatc agcaaagtacaggcgaaagctgcggtcgagtccctcgtcgctcaggcatacaaaggtgcc aaagacggttttacgatcccgggtgttggtaaactggttaaagtgaaacgcaaagctcgc atgggccgcaatcctgctactggcgaaacgatcaaaattcctgcaaaaacggttctcaag ttccgtattgctaaagccgctaaagacgcgattctcggctaa

DBGET integrated database retrieval system