Triticum aestivum (bread wheat): 100270651 Help Entry 100270651         CDS       T07757                                  Name (RefSeq) calmodulin-3   KO K02183   calmodulin Organism taes  Triticum aestivum (bread wheat) Pathway taes04016   MAPK signaling pathway - plant taes04070   Phosphatidylinositol signaling system taes04075   Plant hormone signal transduction taes04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:taes00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     100270651    04070 Phosphatidylinositol signaling system     100270651    04075 Plant hormone signal transduction     100270651  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     100270651  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:taes01009]     100270651   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     100270651    03036 Chromosome and associated proteins [BR:taes03036]     100270651   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:taes04147]     100270651 Protein phosphatases and associated proteins [BR:taes01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100270651 Membrane trafficking [BR:taes04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100270651 Chromosome and associated proteins [BR:taes03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100270651 Exosome [BR:taes04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100270651 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M EFhand_Ca_insen Dockerin_1 RNA_pol_Rpb4 Caleosin FCaBP_EF-hand SPEF2_C MotA_activ PA_Ig-like DUF6279 Fe_hyd_lg_C SurA_N_3 MecA_N Motif Other DBs NCBI-GeneID:  100270651 NCBI-ProteinID:  XP_044340015 LinkDB All DBs Position 3A:253726547..253729870 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMVREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaccagctcaccgacgaccagatcgccgaattcaaggaggctttcagcctcttc gacaaggatggggacggttgcattaccaccaaggagctgggaactgtcatgcgttccctg gggcagaatcccactgaggcagagcttcaagacatgatcaatgaggtggatgctgacggc aatggaacaattgatttccctgaattcctcaaccttatggcccgcaagatgaaggacact gattctgaggaagaactcaaggaggcattccgtgtgtttgacaaggatcaaaatggtttt atctctgctgctgaactgcgccatgtcatgaccaaccttggtgagaagttgactgatgag gaggttgacgagatggtccgtgaggctgatgttgatggtgatggccagatcaactatgat gaatttgttaaagtcatgatggccaagtaa

DBGET integrated database retrieval system