Triticum aestivum (bread wheat): 123047226 Help Entry 123047226         CDS       T07757                                  Name (RefSeq) sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism taes  Triticum aestivum (bread wheat) Pathway taes03018   RNA degradation taes03040   Spliceosome Brite KEGG Orthology (KO) [BR:taes00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     123047226   09123 Folding, sorting and degradation    03018 RNA degradation     123047226  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:taes03019]     123047226    03041 Spliceosome [BR:taes03041]     123047226 Messenger RNA biogenesis [BR:taes03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      123047226   mRNA degradation factors    5'-3' decay     Lsm complex      123047226 Spliceosome [BR:taes03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     123047226 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF150_C Hfq Motif Other DBs NCBI-GeneID:  123047226 NCBI-ProteinID:  XP_044326662 LinkDB All DBs Position 2B:761399263..761401354 Genome browser AA seq 100 aa AA seqDB search MAGRKETALDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVESEREQDDPLKL STKTRQLGLIVCRGTAVMLVSPTDGTDEIANPFLAAEGAS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcgggccgcaaggagacggcgctggacctggccaagttcgtcgacaagggcgtccag gtcaagctcaccggcggccgccaagttacaggaaccttgaagggatatgaccagctgctc aacttagtgctggatgaagcagtcgagtctgaaagagagcaagatgacccattgaagctg tcaaccaagaccagacaacttggtctcattgtgtgcagaggcactgctgtcatgctggtg tcaccaactgatggaaccgacgagattgccaaccccttcctcgcagcggagggggcgtca taa

DBGET integrated database retrieval system