Triticum aestivum (bread wheat): 123061668 Help Entry 123061668         CDS       T07757                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism taes  Triticum aestivum (bread wheat) Pathway taes04145   Phagosome taes04148   Efferocytosis taes04517   IgSF CAM signaling taes04518   Integrin signaling taes04620   Toll-like receptor signaling pathway taes05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:taes00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     123061668    04518 Integrin signaling     123061668  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123061668    04148 Efferocytosis     123061668  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123061668  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123061668  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     123061668   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:taes04147]     123061668    04031 GTP-binding proteins [BR:taes04031]     123061668 Membrane trafficking [BR:taes04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     123061668  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     123061668   Macropinocytosis    Ras GTPases     123061668  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     123061668 Exosome [BR:taes04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123061668   Exosomal proteins of other body fluids (saliva and urine)    123061668   Exosomal proteins of colorectal cancer cells    123061668   Exosomal proteins of bladder cancer cells    123061668 GTP-binding proteins [BR:taes04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     123061668 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  123061668 NCBI-ProteinID:  XP_044340796 UniProt:  A0A3B5Y3T2 LinkDB All DBs Position 1A:complement(516049141..516052533) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVTKKWIPELRHYAPGVPIILVGTKL DLRDDEQFFVDHPGAVPISTAQGEELKKVIGATTYVECSSKTQQNIKAVFDAAIKVVLQP PKQKRKKRKSQKGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcttctcggttcatcaagtgcgtgacggtgggggacggcgccgtcggcaagact tgcctcctcatctcctacacatccaacaccttccccaccgactatgtcccaacagtcttc gacaacttcagcgctaacgtcgtggttgacgggagcaccgtcaacctcggattatgggat actgcaggacaagaggactataatagactacgcccactaagctaccgaggtgccgatgtc ttcctgctcgccttctctcttatcagcaaagcaagctacgagaatgtcaccaagaagtgg atccctgagctacggcactatgctcctggtgtgcccataattcttgttgggacaaagctt gatctgcgggatgacgagcagtttttcgtggatcaccctggagctgttcctatttccacc gctcagggtgaagagctgaagaaggtaattggcgcgacgacctacgtcgagtgcagctca aaaacacagcagaacatcaaggcggtgtttgatgcggcgatcaaggtggttctccagcct ccgaagcagaagcggaagaagaggaagtcgcagaaaggatgcagcatcttgtaa

DBGET integrated database retrieval system