Triticum aestivum (bread wheat): 123069356 Help Entry 123069356         CDS       T07757                                  Name (RefSeq) rac-like GTP-binding protein 1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism taes  Triticum aestivum (bread wheat) Pathway taes04145   Phagosome taes04148   Efferocytosis taes04517   IgSF CAM signaling taes04518   Integrin signaling taes04620   Toll-like receptor signaling pathway taes05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:taes00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     123069356    04518 Integrin signaling     123069356  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123069356    04148 Efferocytosis     123069356  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123069356  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123069356  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     123069356   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:taes04147]     123069356    04031 GTP-binding proteins [BR:taes04031]     123069356 Membrane trafficking [BR:taes04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     123069356  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     123069356   Macropinocytosis    Ras GTPases     123069356  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     123069356 Exosome [BR:taes04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123069356   Exosomal proteins of other body fluids (saliva and urine)    123069356   Exosomal proteins of colorectal cancer cells    123069356   Exosomal proteins of bladder cancer cells    123069356 GTP-binding proteins [BR:taes04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     123069356 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  123069356 NCBI-ProteinID:  XP_044348125 LinkDB All DBs Position 3B:complement(200806710..200808530) Genome browser AA seq 222 aa AA seqDB search MSGGAGAGAAAAAAVSRFIKCVAVGDGAVGKTCMLICYTCNKFPTDYIPTVFDNFSANVS VDGSIVNLGLWDTAGQEDYSRLRPLSYRGADVFILSFSLTSRASYENVHKKWMPELRRYA PGIPVLLVGTKLDLREDRAYLADHAADSIITTEQGEELRRQIGAVAYIECSSKTQRNIKA VFDTAIKAVLQPQRHKEVAKKEIRTRSSRSVRRYFCGSVCLA NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgagcggcggagcgggagcgggggcggcggcggcggcggcggtgagcaggttcatcaag tgcgtggccgtgggcgacggcgccgtgggcaagacctgcatgctcatctgctacacctgc aacaagttccccaccgactacatccccaccgtgttcgacaacttcagcgccaatgtctcc gtggacggcagcatcgtcaacctcggcctctgggacaccgcaggtcaggaggattacagc cggctgaggcctctgagctacaggggagccgatgtcttcatcctctccttctccctcacc agcagagcaagctatgagaatgtgcacaagaagtggatgccggagcttcgccggtacgcc cccggaattcctgtactacttgttggaaccaagttggatctccgagaagatagagcttat cttgctgatcatgcagctgattccatcataacaactgagcagggtgaggagcttcggaga caaataggtgcggtggcatacatagaatgcagctccaagacacaaagaaacattaaggct gtctttgacaccgcaatcaaggcggttcttcaacctcaaaggcacaaggaggtagccaaa aaggaaatccggactcgctctagtcggtcagtaaggcggtacttctgcgggagtgtttgc ttagcatag

DBGET integrated database retrieval system