Triticum aestivum (bread wheat): 123072600
Help
Entry
123072600 CDS
T07757
Name
(RefSeq) protein DETOXIFICATION 40-like
KO
K03327
MATE family, multidrug and toxin extrusion protein
Organism
taes
Triticum aestivum (bread wheat)
Brite
KEGG Orthology (KO) [BR:
taes00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
taes02000
]
123072600
Transporters [BR:
taes02000
]
Solute carrier family (SLC)
SLC47: Multidrug and Toxin Extrusion (MATE) family
123072600
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MatE
Motif
Other DBs
NCBI-GeneID:
123072600
NCBI-ProteinID:
XP_044352117
LinkDB
All DBs
Position
3B:complement(812791038..812800856)
Genome browser
AA seq
492 aa
AA seq
DB search
MADGEAPGRLESILTDSSAPLAGRVWAAGAIELRMLTRLAAPAVVMYMINYLMSMSTQIF
SGHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAFGAQKKDMLGTYLQRSAVL
LCCTGIPLAVIYAFSEPLLVLLGQSPEIAHAASIFVYGLIPQIFAYAINFPIQKFMQAQS
IVLPSAYISTVTLVLHLLLSWVVVYKAGLGLLGASLVLSLSWWVIVAAQFAYIVVSPTCR
ETWTGFTWQAFSGLPAFLKLSAASAVMLCLETWYFQILVLIAGLLPDPEIALDSLSVCMT
ISGWVFMISVGFNAAASVRVSNELGAGNPKSAFFSVWVVTSLCAAISVVFAIVMLCLRNH
ISYLFTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYYIVG
VPLGIVLGFVFNLGVKGIWSGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWDDTK
KQPLLTAATDNS
NT seq
1479 nt
NT seq
+upstream
nt +downstream
nt
atggcggacggggaagcgccggggcggctggagagcatcctgacggactcgtcggcgccg
ctggcggggcgcgtgtgggcggcgggggcgatcgagctccggatgctgacgcggctggcg
gcgccggcggtggtcatgtacatgatcaactacctcatgtccatgtccacgcagatcttc
tccggccacctcggcagcctggagctcgccgccgcctccctcggcaacaccggcgtccag
atgttcgcctacggcctcatgctaggcatgggtagcgcagtggagaccctgtgcggacaa
gccttcggtgcgcaaaagaaagacatgctcggaacctacctgcaacgctccgccgtgctc
ctatgctgcaccggcataccgctcgccgtgatctacgccttctcagagccactcctcgtg
ctactggggcagtcaccggagatagcccacgccgcgtcgatcttcgtctacggcctcatc
cctcagatcttcgcgtacgccatcaacttcccgatccagaagttcatgcaggcgcagagc
atcgtcctgcccagtgcctacatctccacggtcacgctcgtgctgcacctgctgctcagc
tgggtcgtcgtctacaaggccggcctcggcctgctcggcgcctcgctggtgctcagcctg
agctggtgggtcatcgtcgcggcgcagttcgcgtacatcgtcgtgagcccgacgtgccgg
gagacgtggactgggttcacctggcaggccttctccggcttgccggcctttctcaagctc
tccgccgcgtctgctgtcatgctgtgccttgagacgtggtactttcagatcctggtgctc
attgctgggttgctccccgaccctgagattgccctggattccctctctgtgtgtatgaca
atctccggatgggtgttcatgatctcagtaggtttcaacgccgccgcaagtgttagagtg
agcaatgagcttggtgccggcaaccccaagtcagcatttttctcagtgtgggtcgtcact
tcgctctgtgcagccatctctgttgtctttgccattgtgatgctctgcctacgcaaccac
atcagctacttgttcacagagagtgaaatagtttccgacgcggtggcggatctctgccca
cttcttgccatcacgctcattctcaatggcatacagcctgtactgtcaggtgttgctgtt
ggatgtggatggcaacagtttgttgcatacgtgaacattggttgttactacatcgtaggc
gtaccccttggcattgttctcggttttgtcttcaacctcggcgtaaagggcatttggagt
ggcatgattggaggaacgactatgcagacggccattctactgtgggtcaccatcagaacc
gattggagcaaagaggttgaggaggcacataaaagattgaacaagtgggatgataccaag
aaacagcccctccttacggcggccacggataatagctaa
DBGET
integrated database retrieval system