Triticum aestivum (bread wheat): 123082931 Help Entry 123082931         CDS       T07757                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism taes  Triticum aestivum (bread wheat) Pathway taes03083   Polycomb repressive complex taes04120   Ubiquitin mediated proteolysis taes04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:taes00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123082931    04120 Ubiquitin mediated proteolysis     123082931   09126 Chromosome    03083 Polycomb repressive complex     123082931  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     123082931    04121 Ubiquitin system [BR:taes04121]     123082931    03036 Chromosome and associated proteins [BR:taes03036]     123082931 Membrane trafficking [BR:taes04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     123082931 Ubiquitin system [BR:taes04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      123082931    Cul7 complex      123082931 Chromosome and associated proteins [BR:taes03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      123082931   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      123082931 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 M-HEAT_ATR Motif Other DBs NCBI-GeneID:  123082931 NCBI-ProteinID:  XP_044361058 UniProt:  A0A3B6I4E0 LinkDB All DBs Position 4A:658501390..658503122 Genome browser AA seq 149 aa AA seqDB search MAAAEAGETKMIILKSSDEEEFEVEEVVAMESQTIRHMIDDGCANNKILLPITNSKILFK VIEYCKKHIQAKPTTDTTTRASEAYDVVAPAGPVEDLKNWDAEFVRVNESTLFDLAMAAR YLNIKGLLDLTTETLADMIKGKNSEELLG NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcggaggcaggcgagactaagatgatcattctcaagagctcagatgaggag gagtttgaggtggaggaggttgtcgccatggagtcgcagaccatccgccacatgatcgat gacggctgtgccaacaacaagatcctgctccccatcaccaactccaagatcctcttcaag gtcatcgagtactgcaagaagcacatccaggctaagcccaccacagacaccaccaccaga gcttccgaagcatatgatgttgtggcacctgccggccccgtcgaggacctcaagaactgg gatgccgaatttgtcagggtcaacgagtccaccctttttgacctcgctatggctgcaagg tatctcaacatcaagggactgctagacctgaccaccgagactcttgccgacatgataaag ggcaagaattcggaggagcttctaggctga

DBGET integrated database retrieval system