Triticum aestivum (bread wheat): 123086369 Help Entry 123086369         CDS       T07757                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism taes  Triticum aestivum (bread wheat) Brite KEGG Orthology (KO) [BR:taes00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:taes03041]     123086369   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:taes04052]     123086369 Spliceosome [BR:taes03041]  Complex B   Other components    Complex B specific factors     123086369 Cytokines and neuropeptides [BR:taes04052]  Neuropeptides   Unclassified    123086369 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  123086369 NCBI-ProteinID:  XP_044364062 LinkDB All DBs Position 4A:complement(463826624..463828647) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRAEKIRIQKWYTIYKDHITLGDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctcaacgaccgcctggggaagaaggtgcgcgtcaagtgcaacgag gacgacaccatcggcgacctcaagaagctcgtggcggcgcagaccgggaccagggccgag aagatccgcatccagaagtggtacaccatctacaaggaccacatcaccctcggcgactac gagatccacgacggcatgggcctcgagctctactacaactag

DBGET integrated database retrieval system