Triticum aestivum (bread wheat): 123096731 Help Entry 123096731         CDS       T07757                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism taes  Triticum aestivum (bread wheat) Pathway taes04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:taes00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     123096731  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:taes04121]     123096731    03400 DNA repair and recombination proteins [BR:taes03400]     123096731 Ubiquitin system [BR:taes04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      123096731    Cul5 complex      123096731 DNA repair and recombination proteins [BR:taes03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      123096731 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  123096731 NCBI-ProteinID:  XP_044374427 LinkDB All DBs Position 4D:121623787..121627597 Genome browser AA seq 120 aa AA seqDB search MVGKGGEAAASAQHKEEHEEDGDMVGVVKLISAEGFEFVIDKKAAMVSNTLRNMLTSPGG FAETREGEVRFPEISTAILEKICQYFYWSLHYASGKETAEFPIEPEITLELMMAANYLDT NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggtggggaaaggaggcgaggccgcggcgtcggcgcagcacaaggaggagcacgaggaa gacggcgacatggttggcgtggtgaagctgatcagcgccgagggtttcgagttcgtcatc gacaagaaggcagccatggtctccaacaccctcaggaacatgctcacctcacctggtggc ttcgcggagacgcgcgagggcgaggtgaggttcccggagatcagcaccgcgatcctagag aagatctgccagtacttctactggtcgctccactacgccagtgggaaggagacggcggag ttcccgatcgagccagaaataacgctggagctgatgatggctgcaaactacctcgacact tag

DBGET integrated database retrieval system