KEGG   Triticum aestivum (bread wheat): 123104620
Entry
123104620         CDS       T07757                                 
Name
(RefSeq) SKP1-like protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
taes  Triticum aestivum (bread wheat)
Pathway
taes03083  Polycomb repressive complex
taes04120  Ubiquitin mediated proteolysis
taes04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:taes00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    123104620
   04120 Ubiquitin mediated proteolysis
    123104620
  09126 Chromosome
   03083 Polycomb repressive complex
    123104620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:taes04131]
    123104620
   04121 Ubiquitin system [BR:taes04121]
    123104620
   03036 Chromosome and associated proteins [BR:taes03036]
    123104620
Membrane trafficking [BR:taes04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    123104620
Ubiquitin system [BR:taes04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     123104620
   Cul7 complex
     123104620
Chromosome and associated proteins [BR:taes03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     123104620
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     123104620
SSDB
Motif
Pfam: Skp1 Skp1_POZ BTB
Other DBs
NCBI-GeneID: 123104620
NCBI-ProteinID: XP_044382435
LinkDB
Position
5A:complement(540987339..540990298)
AA seq 166 aa
MAASAAAKKLTLKSSDGEDFEVEVAVAMASQTIKHMVEDGCADNIIPLPNVNAKVLSKVI
EYCTQHAPKADDAATADSATAVKPDEETLKAFDAEFVKVEQATLFDLILAANYLDIKGLL
DLTCQTVADMIKGKTPEEIRKTFNITNDFTPEEEEEVRKENQWAFE
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcggcatcggcggcggcgaagaagctcacgctcaagagctccgacggcgaggacttc
gaggtggaggtggcggtggcgatggcgtcgcagaccatcaagcacatggtggaggacggc
tgcgccgacaacatcatcccgctccccaacgtcaacgccaaggtcctctccaaggtcatc
gagtactgcacgcagcacgcccccaaggcagacgacgccgccaccgccgactccgccacc
gccgtcaagcccgacgaggagacgctcaaggccttcgacgccgaattcgtcaaggtcgag
caggcgactctcttcgacctcatcctggctgccaactacctggacatcaaggggctcctg
gacctgacctgccagaccgtcgccgacatgatcaagggcaagactccggaggagatccgc
aagaccttcaacatcaccaacgacttcaccccggaggaggaggaggaagtgcggaaggag
aaccagtgggcctttgagtga

DBGET integrated database retrieval system