Triticum aestivum (bread wheat): 123107332
Help
Entry
123107332 CDS
T07757
Name
(RefSeq) SKP1-like protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
taes
Triticum aestivum (bread wheat)
Pathway
taes03083
Polycomb repressive complex
taes04120
Ubiquitin mediated proteolysis
taes04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
taes00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
123107332
04120 Ubiquitin mediated proteolysis
123107332
09126 Chromosome
03083 Polycomb repressive complex
123107332
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
taes04131
]
123107332
04121 Ubiquitin system [BR:
taes04121
]
123107332
03036 Chromosome and associated proteins [BR:
taes03036
]
123107332
Membrane trafficking [BR:
taes04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
123107332
Ubiquitin system [BR:
taes04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
123107332
Cul7 complex
123107332
Chromosome and associated proteins [BR:
taes03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
123107332
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
123107332
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Motif
Other DBs
NCBI-GeneID:
123107332
NCBI-ProteinID:
XP_044385253
LinkDB
All DBs
Position
5A:493569658..493571941
Genome browser
AA seq
223 aa
AA seq
DB search
MAAEGQEKEKMVMLRSEDGVDFVLSESEAEAQCGRKIKIMMKHDFENHIIPSGDGGGGEI
NYCLIRLPVRGDTLSKVIDYSKMHASGSHDFDPLGCGLHRCFQPRGPLRSHPGEYASKYL
QIRGLIDLAWQTIASKIKGKSPREICNIFNIKSVFPPELDGETIAKRLQDCTTCSSDKEL
PCSETPYLIQELEFEEKALQALDIVHCQEFTGYDPKVNTYTRT
NT seq
672 nt
NT seq
+upstream
nt +downstream
nt
atggcggcggaggggcaggaaaaggagaagatggtgatgttgcggagcgaggacggcgtg
gacttcgtgctgtcagagtccgaggcagaggcccagtgcggcaggaaaatcaaaataatg
atgaagcacgacttcgagaaccacatcatcccttccggcgacggcggcggcggcgaaatc
aactactgcctcatccgcctccccgtccgaggcgacacactctccaaggtgatagactac
tccaagatgcacgcctccggatcccacgactttgacccactgggatgcggacttcatcgc
tgctttcaaccacgaggccctcttcgatctcatcctggtgagtacgcttcgaaatatctt
caaataagaggactgattgacctagcctggcagactattgctagtaagataaaggggaaa
tctccacgtgaaatttgtaatatcttcaacatcaagagtgtctttcctccggaattagat
ggagaaacgatagcaaagcgattgcaagattgcacaacatgttccagtgacaaggagttg
ccatgcagtgagaccccatatttaattcaagagctcgaattcgaggaaaaggctttgcag
gctcttgacatagttcattgtcaagagtttacgggatacgaccctaaggtcaacacttac
acccgtacctga
DBGET
integrated database retrieval system