Triticum aestivum (bread wheat): 123122046 Help Entry 123122046         CDS       T07757                                  Name (RefSeq) SKP1-like protein 18   KO K03094   S-phase kinase-associated protein 1 Organism taes  Triticum aestivum (bread wheat) Pathway taes03083   Polycomb repressive complex taes04120   Ubiquitin mediated proteolysis taes04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:taes00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123122046    04120 Ubiquitin mediated proteolysis     123122046   09126 Chromosome    03083 Polycomb repressive complex     123122046  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     123122046    04121 Ubiquitin system [BR:taes04121]     123122046    03036 Chromosome and associated proteins [BR:taes03036]     123122046 Membrane trafficking [BR:taes04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     123122046 Ubiquitin system [BR:taes04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      123122046    Cul7 complex      123122046 Chromosome and associated proteins [BR:taes03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      123122046   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      123122046 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HNH Motif Other DBs NCBI-GeneID:  123122046 NCBI-ProteinID:  XP_044398115 LinkDB All DBs Position 5D:complement(391624860..391626126) Genome browser AA seq 132 aa AA seqDB search MVAEGEEKEKMVMLRSEDGVDFLLSEAEAEAHCGRKIKIMMKYDSEDHIIPSDDGGGEIN YCLIRLPVRGDTLSKVIDYSKMHASGSHDLTHWDAEFIAGFNHEALFHLILVSTYIHTFP KKRSKKSYTSIN NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggtggcggagggggaggaaaaggagaagatggtgatgttgcggagcgaggacggcgtg gacttcctgctgtcagaggcagaggccgaggcccattgcggcaggaaaatcaaaataatg atgaagtacgactccgaggaccacatcatcccttccgacgacggcggcggcgaaatcaac tactgcctcatccgcctccccgtccgaggcgacacactctccaaggtgatagactactcc aagatgcacgcctccggatcccacgacttgacccactgggatgcggagttcatcgctggt ttcaaccacgaggccctcttccatctcatcctggtgagtacgtacatacatactttccca aaaaaaagatctaagaaaagttatacctcaatcaattga

DBGET integrated database retrieval system