Triticum aestivum (bread wheat): 123124461 Help Entry 123124461         CDS       T07757                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism taes  Triticum aestivum (bread wheat) Pathway taes03083   Polycomb repressive complex taes04120   Ubiquitin mediated proteolysis taes04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:taes00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123124461    04120 Ubiquitin mediated proteolysis     123124461   09126 Chromosome    03083 Polycomb repressive complex     123124461  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     123124461    04121 Ubiquitin system [BR:taes04121]     123124461    03036 Chromosome and associated proteins [BR:taes03036]     123124461 Membrane trafficking [BR:taes04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     123124461 Ubiquitin system [BR:taes04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      123124461    Cul7 complex      123124461 Chromosome and associated proteins [BR:taes03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      123124461   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      123124461 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  123124461 NCBI-ProteinID:  XP_044401010 UniProt:  A0A3B6MMI2 LinkDB All DBs Position 5D:119623457..119624864 Genome browser AA seq 146 aa AA seqDB search MESQTIRHMIEDDCANKGIPIPNINSKALSKVIEYCNKHVMAKTVDVSSGSTGVAASDTM APAALAGDLKIWDAEFINVDPDTHFDLIKAASYLNIKGLLDLTCQTTADMISGKPPEEIR NFFKIQNDYLPEEEEKIRRENQWAFQ NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggagtcgcagaccatccgccacatgatcgaggatgactgcgccaacaaaggcatcccg atccccaacatcaactccaaggccctctccaaggtcatcgagtactgcaacaaacatgtc atggccaagacagtcgatgtctctagtggatccacaggtgttgctgcatccgacaccatg gctcccgccgccctagccggggacctcaagatctgggacgcagaattcatcaacgtcgac cctgacacccactttgacctcatcaaggcagcaagttacctcaacatcaaggggttgttg gacctgacttgccagactactgcagacatgattagcggaaaacctccggaggagattcgt aatttcttcaagatccagaacgactacttgccagaggaggaggagaagatccgcagggag aaccagtgggcatttcagtag

DBGET integrated database retrieval system