KEGG   Triticum aestivum (bread wheat): 123130789
Entry
123130789         CDS       T07757                                 
Name
(RefSeq) protein DETOXIFICATION 49-like
  KO
K03327  MATE family, multidrug and toxin extrusion protein
Organism
taes  Triticum aestivum (bread wheat)
Brite
KEGG Orthology (KO) [BR:taes00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:taes02000]
    123130789
Transporters [BR:taes02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   123130789
SSDB
Motif
Pfam: MatE
Other DBs
NCBI-GeneID: 123130789
NCBI-ProteinID: XP_044406534
UniProt: A0A3B6NQI0
LinkDB
Position
6A:478362809..478364882
AA seq 572 aa
MSSCSDSTVTMSYRHGEYAGDGITAPLLPIAEVVVPMEELPPVLTCKPPGRLARAVKEAW
SVSLSLAFPMLPSMSAAAAGEEARSILGLAMPMILTGLLLYLRSMISMLFLGRLGGLALA
GGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAGHYELLGVTMQRTVLLLVAAAVPIGG
LWMHMRPLLLLCGQDVGIAAVAETYILSSLPDLFLQAFLHPVRIYLRTQSINLPLTVCAA
LAIALHLPINYVLVSVLGHGIRGVAFASVLANLNFLLLLLGYILVKGVHKRTGGFVFSAE
SFRGWGELVSLALPSCVSVCLEWWWYEIMILLCGLLANPQATVASMGILIQATSLIYIFP
SSLGFGVSTRVSNELGANRAERAGRAATVGLMLGFAFGGVASAFAYMVRGSWAGMFTADP
AIITLTASVLPILGACELGNCPQTAGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAF
WFHYDFQGLWLGLLAAQAACMVRMLLVIGRTDWAAEAKRAQQLAGAGAVTVAVDTKPSSG
KGIHVVRVAAGGGDENSGLLIDVVIEQPNDQR
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgtcgtcctgctccgactccacggtcaccatgtcgtaccggcatggtgagtatgcgggc
gatggcatcacggcccctttgctccccattgcggaggtggtcgtgcccatggaggagctg
ccgcctgtgctcacttgcaagccgccaggtcggcttgccagagcggtgaaggaagcctgg
tccgtttctttgtccttggcattccccatgctgccgtcgatgtcggccgccgcggccggg
gaggaggcgcggtccatactgggcctcgcgatgccgatgatcctcacggggctgctgctc
tacctccggtccatgatttcgatgctcttcctcggccgcctcgggggcctggcgctcgcc
ggcgggtcactcgccatcggcttcgccaacatcaccggctactccgtgctgtctggcctc
gccatgggtatggagccgatctgtgggcaggccttcggcgcaggccattacgagctcctc
ggtgtcaccatgcagcgcaccgtgctgcttctcgtcgcggccgctgttcccatcggcggg
ctgtggatgcatatgcgacctctgctcttgctctgcggccaggacgtcggcatcgcagcg
gtcgccgagacctacattctttcctccctgccggacctcttcctccaggcattcctccac
cccgtccgcatctacctccggacgcaatccatcaacttgccgctcaccgtgtgcgccgcg
ctcgccattgcactccacctgcccatcaactacgtgctcgtctctgtcctcggacacggc
atcaggggggtggcatttgcctctgttctcgccaacctaaacttccttctcctccttctt
ggttacatattggtcaagggagtgcataagcgcaccggcggctttgtgttctcggccgag
agcttccgtggctggggagagctcgtaagcctcgccctgccgagctgcgtcagtgtctgc
ctcgagtggtggtggtacgagatcatgatcctcctgtgcggcctgctcgccaacccacag
gccactgtggcctccatgggaatcttgatccaggctacgtcactcatctacatcttccct
tcctcgcttggcttcggcgtgtccacccgcgtcagcaacgaactcggcgcaaaccgtgcc
gagcgtgcgggccgtgccgccacggttggcctcatgctcgggttcgcgttcggcggcgtg
gcatcggcgttcgcgtacatggtgcggggctcgtgggctggcatgttcacggcggacccg
gcgatcatcacgctcaccgcgtccgtgctgccgatcctgggagcatgcgagctcggtaac
tgtccgcagacggcggggtgtggcgtgctgcggggcagcgcgcggcccaaggacgccgcc
agcatcaacctccggtccttctacctcgtcggcacgccggtggctctcgtcctcgcgttc
tggttccactacgacttccagggcctgtggctcggcctcctcgcggcgcaggccgcctgc
atggtgcgcatgctgctggtcatcgggcggacggattgggctgcggaggccaagcgcgcg
cagcagctcgccggagcaggcgcggtaacggtggcagtcgacacaaaaccgagcagcggc
aaaggcattcacgtcgtgagagtcgcggccggcggcggcgatgagaactccgggctgctt
atcgatgttgtcatcgagcaaccaaacgatcagcgctga

DBGET integrated database retrieval system