KEGG   Triticum aestivum (bread wheat): 123131642
Entry
123131642         CDS       T07757                                 
Name
(RefSeq) aspartate aminotransferase, mitochondrial-like
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
taes  Triticum aestivum (bread wheat)
Pathway
taes00220  Arginine biosynthesis
taes00250  Alanine, aspartate and glutamate metabolism
taes00270  Cysteine and methionine metabolism
taes00330  Arginine and proline metabolism
taes00350  Tyrosine metabolism
taes00360  Phenylalanine metabolism
taes00400  Phenylalanine, tyrosine and tryptophan biosynthesis
taes00710  Carbon fixation by Calvin cycle
taes00950  Isoquinoline alkaloid biosynthesis
taes00960  Tropane, piperidine and pyridine alkaloid biosynthesis
taes01100  Metabolic pathways
taes01110  Biosynthesis of secondary metabolites
taes01200  Carbon metabolism
taes01210  2-Oxocarboxylic acid metabolism
taes01230  Biosynthesis of amino acids
Module
taes_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
taes_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:taes00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    123131642
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    123131642
   00270 Cysteine and methionine metabolism
    123131642
   00220 Arginine biosynthesis
    123131642
   00330 Arginine and proline metabolism
    123131642
   00350 Tyrosine metabolism
    123131642
   00360 Phenylalanine metabolism
    123131642
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    123131642
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    123131642
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    123131642
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:taes01007]
    123131642
Enzymes [BR:taes01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     123131642
Amino acid related enzymes [BR:taes01007]
 Aminotransferase (transaminase)
  Class I
   123131642
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 123131642
NCBI-ProteinID: XP_044407246
LinkDB
Position
6A:10376051..10380215
AA seq 426 aa
MALYRRAASAIRRRGAGGLPLLPARAMASLFGHVEPAPKDPILGVTEAFLADPSPDKVNV
GVGAYRDDSGKPVVLDCVREAERRIAGNLNMEYLPMGGSIHMIEESLKLAYGEDSEFIKD
KRIAAVQALSGTGACRLFADFQKRFLPDSQIYIPTPTWSNHHNIWRDAQVPQRTFSYYHP
ESRGLDFAGLMDDIKNAPNGSFFLLHACAHNPTGVDPTEEQWREISYQFKLKNHFPFFDM
AYQGFASGDPERDAKAIRIFLEDGHQIGCAQSYAKNMGLYGQRAGCLSILCEDEMQAVAV
KSQLQQIARPMYSNPPVHGALVVSIILSDPELKNVWLGEVKGMADRIIGMRKALRENLEK
LGSPLSWEHVTNQIGMFCYSGMTPEQVDRLTSEYHIYMTRNGRISMAGVTTGNVAYLANA
IHDVTK
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcgctgtaccgccgcgcggcctccgcgatccggcggcgcggggcagggggcctgccc
ctgctcccggcgcgggcgatggcgtcgctcttcggccacgtcgagccggcgcccaaggac
cccatcctcggcgtcaccgaggccttcctcgccgacccctcccccgacaaagtcaacgtc
ggcgtcggcgcctaccgggacgacagcggcaagcccgtcgtgctcgactgcgtgcgcgag
gcggagcgccggatcgccggcaacctcaacatggagtaccttccaatgggagggagtatc
cacatgattgaagagtcgctaaagctggcgtatggcgaggactccgagttcatcaaagat
aaaagaattgcagcggtgcaggcactttcaggaactggcgcatgccggctcttcgctgat
ttccagaagcgtttcctgccggattcgcagatctacatacctacaccaacttggtccaac
catcataatatttggagggatgctcaagtgccacagaggacattctcatattaccatccg
gaatcgagagggcttgactttgcaggattgatggatgatatcaagaatgctccaaatggt
tcattctttttgcttcatgcatgtgcccataatcctactggagtagatcctactgaggaa
caatggcgagaaatatcctatcagttcaagttgaagaaccatttcccattctttgacatg
gcataccaaggatttgccagcggtgatccagagagagatgccaaggcaatccgtatattc
cttgaagatggacaccaaattggatgtgctcagtcatatgcaaagaacatgggtctttat
ggacagagagcgggatgcctgagtatcctctgcgaggatgagatgcaagcagttgctgtt
aagagccaattgcaacagattgcgagaccaatgtacagcaacccacctgttcatggtgcg
ctggttgtttcaattatccttagtgatccagaattgaagaacgtatggttaggagaggtc
aagggcatggctgatcgtatcattggaatgcggaaggcacttcgggagaatcttgaaaag
ttaggttcacctttatcatgggagcatgtcaccaatcagattggaatgttttgctacagt
gggatgacacctgaacaagtcgatcgcctgacaagtgaataccatatctacatgacacgc
aatgggagaataagcatggccggcgtaacgacgggcaacgtcgcctacttggctaatgcc
attcatgatgttaccaagtga

DBGET integrated database retrieval system