Triticum aestivum (bread wheat): 123135434
Help
Entry
123135434 CDS
T07757
Name
(RefSeq) aspartate aminotransferase, mitochondrial-like
KO
K14455
aspartate aminotransferase, mitochondrial [EC:
2.6.1.1
]
Organism
taes
Triticum aestivum (bread wheat)
Pathway
taes00220
Arginine biosynthesis
taes00250
Alanine, aspartate and glutamate metabolism
taes00270
Cysteine and methionine metabolism
taes00330
Arginine and proline metabolism
taes00350
Tyrosine metabolism
taes00360
Phenylalanine metabolism
taes00400
Phenylalanine, tyrosine and tryptophan biosynthesis
taes00710
Carbon fixation by Calvin cycle
taes00950
Isoquinoline alkaloid biosynthesis
taes00960
Tropane, piperidine and pyridine alkaloid biosynthesis
taes01100
Metabolic pathways
taes01110
Biosynthesis of secondary metabolites
taes01200
Carbon metabolism
taes01210
2-Oxocarboxylic acid metabolism
taes01230
Biosynthesis of amino acids
Module
taes_M00170
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
taes_M00171
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:
taes00001
]
09100 Metabolism
09102 Energy metabolism
00710 Carbon fixation by Calvin cycle
123135434
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
123135434
00270 Cysteine and methionine metabolism
123135434
00220 Arginine biosynthesis
123135434
00330 Arginine and proline metabolism
123135434
00350 Tyrosine metabolism
123135434
00360 Phenylalanine metabolism
123135434
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
123135434
09110 Biosynthesis of other secondary metabolites
00950 Isoquinoline alkaloid biosynthesis
123135434
00960 Tropane, piperidine and pyridine alkaloid biosynthesis
123135434
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
taes01007
]
123135434
Enzymes [BR:
taes01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.1 aspartate transaminase
123135434
Amino acid related enzymes [BR:
taes01007
]
Aminotransferase (transaminase)
Class I
123135434
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Motif
Other DBs
NCBI-GeneID:
123135434
NCBI-ProteinID:
XP_044410443
UniProt:
A0A3B6PG68
LinkDB
All DBs
Position
6B:complement(18951609..18956035)
Genome browser
AA seq
426 aa
AA seq
DB search
MALYRRAASAIRQRGALPLLPARAMASLFGHVEPAPKDPILGVTEAFLADPSPDKVNVGV
GAYRDDNGKPVVLDCVREAERRIAGNLNMEYLPMGGSMHMIEESLKLAYGEDSEFIKDKR
IAAVQALSGTGACRLFADFQKRFLPDSQIYIPTPTWSNHHNIWRDAQVPQRTFSYYHPES
RGLDFAGLMDDIKNAPNGSFFLLHACAHNPTGVDPTEEQWREISYQFKLKNHFPFFDMAY
QGFASGDPERDAKAIRIFLEDGHQIGCAQSYAKNMGLYGQRAGCLSILCEDEMQAVAVKS
QLQQIARPMYSNPPVHGALVVSIILSDPELKNVWLGEVKGMADRIIGMRKALRENLEKLG
SPLSWEHVTNQIGMFCYSGMTPEQVDRLTSEYHIYMTRNGRISMAGVTTGNVAYLANAIH
DVTKSN
NT seq
1281 nt
NT seq
+upstream
nt +downstream
nt
atggcgctgtaccgccgcgcggcctccgcgatccggcagcgcggggccctgcccctgctc
ccggcgcgggcgatggcgtcgctcttcggccacgtcgagccggcgcccaaggaccccatc
ctcggcgtcaccgaggccttcctcgccgacccctcccccgacaaagtcaacgtcggcgtc
ggcgcctaccgggacgacaacggcaagcccgtggtgctcgactgcgtgcgcgaggcggag
cgccggatcgccggcaacctcaacatggagtaccttccaatgggagggagtatgcacatg
attgaggagtcactaaagctggcgtacggcgaggactccgagttcatcaaagataaaaga
attgcagcggtgcaggcactttcaggaactggcgcatgccgtctcttcgctgatttccag
aagcgtttcttgccggattcgcagatctacatacctacaccaacgtggtccaaccatcat
aatatttggagggatgctcaagtgccacagaggacattctcatattaccatccggaatcg
agagggcttgactttgcaggattgatggatgatatcaagaatgctccaaatggttcgttc
tttttgcttcatgcatgtgcccataatcctactggagtagatcctactgaggaacaatgg
cgagaaatatcctatcagttcaagttgaagaatcatttcccattttttgacatggcatac
caaggatttgctagcggtgatccagagagagatgccaaggcaatccgtatattccttgaa
gacggacaccaaattggatgtgctcagtcatatgcaaagaacatgggtctttatggccag
agagcgggatgtctgagtatcctctgcgaggatgagatgcaagcagttgctgttaagagc
caattgcaacagattgcgagaccaatgtacagcaacccacctgttcatggtgcattggtt
gtttcaattatccttagtgatccagaattgaagaatgtatggttgggagaggtcaagggt
atggctgatcgtatcattggaatgcggaaggcacttcgggagaatcttgaaaagttaggt
tcacctttatcatgggagcatgtcaccaatcagattggaatgttttgctacagtgggatg
acaccggaacaagtcgatcgcctgacaagtgaataccatatctacatgacacgcaacggg
agaataagcatggccggtgtaacgacgggcaacgtcgcctacttagctaacgccattcat
gatgttaccaagtcaaattga
DBGET
integrated database retrieval system