Triticum aestivum (bread wheat): 123136825
Help
Entry
123136825 CDS
T07757
Name
(RefSeq) exocyst complex component EXO70B1-like
KO
K07195
exocyst complex component 7
Organism
taes
Triticum aestivum (bread wheat)
Brite
KEGG Orthology (KO) [BR:
taes00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
taes04131
]
123136825
03036 Chromosome and associated proteins [BR:
taes03036
]
123136825
Membrane trafficking [BR:
taes04131
]
Exocytosis
Tethering complex
Exocyst complex
123136825
Chromosome and associated proteins [BR:
taes03036
]
Eukaryotic type
Centrosome formation proteins
Other centrosome associated proteins
123136825
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Exo70_C
Exo70_N
Motif
Other DBs
NCBI-GeneID:
123136825
NCBI-ProteinID:
XP_044412269
LinkDB
All DBs
Position
1B:complement(536689985..536692617)
Genome browser
AA seq
653 aa
AA seq
DB search
MAEDGEEKLLATVQHIVQTLGSSDTMTEDILKVFSNYDGRLSLDKIYAARGAVAAAAGGG
GGGGGGERSMPASPPLPPPPAAAVPGSSARPPVTSMERTVRTLDRQISQFVTMDRLIWSD
SGDADAFLEAVDDLIGTVQELDAAGTNRMLLDRADELLSRCMARLEDEFRALIERPDDAA
PSAPGGFASDGSDDEEFYGGADGYGDEPIPIAKPVTDYDVVIDALSPGSIANVHQISRRM
VDAGFGRECAEAYAAARRGFVDESVARLGVRPRTAEEVHASPWEELEFDIARWIPAFNMV
FRILIPSERRLCDRVFDGLAPFGDLAFIAAVRTQALQLISFGDAISSSSRSPERLFRVVD
MYEAVRDILPDLDPVFSDPYSAALRAEVSAVCNTLGSSIKGIFMELENLIRRDPARVATP
GGGIHPITRYVMNYLRAACGSRQTLEEVMEGDLGAGGRASAAVDPDRPTSSLAVHIAWIM
DVLHKNLDTKSKIYRDPSLACIFLMNNGKYIIQKVNDSELGVLLGDDWIKQLSTRVRRWS
MDYQRSTWGKVTTVLQIGGSGVGALPTKAMLQKLRMFNTYFEEIYAVQSEWVVADDQLRM
DVRAAVEDSVMPAYAALIARLKSAPETGRDLYIKYTPEDVEAHIQHLFEGAAK
NT seq
1962 nt
NT seq
+upstream
nt +downstream
nt
atggcggaggacggcgaggagaagctgctcgccacggtccagcacatcgtgcagacgctc
ggcagcagcgacaccatgacggaggacatcctcaaggtcttctccaactacgacggccgc
ctctcgctcgacaagatctacgccgcgcgcggcgccgtggccgccgcggcgggcggcggc
gggggaggaggcggaggggagcgctcgatgccggcgtcgccgccgctgcccccgccgccc
gcggccgccgtgccgggctcctccgcgaggccgcccgtcacgtccatggagcggaccgtg
cgcacgctcgaccgccagatctcgcagttcgtcaccatggacaggctgatctggtccgac
tcgggcgacgccgacgccttcctcgaggccgtcgacgacctcatcggcaccgtgcaggag
ctggacgccgcagggaccaaccgcatgctgctcgaccgcgccgacgagctgctcagccgg
tgcatggcgcggctggaggatgagttccgggccctaatcgagcgccccgacgacgcggcc
ccctcggcgcccggcgggttcgcgtccgacggcagcgacgacgaggagttctacggcggc
gcggacggctacggcgacgagcccatcccgatcgccaagcccgtcaccgactacgacgtc
gtcatcgacgcgctctcgccgggctcgattgccaacgtgcaccagatctcgcgccggatg
gtggacgccggcttcggccgggagtgcgccgaggcctatgccgccgcgcgccggggcttc
gtcgacgagagcgttgcgcgtctcggcgtccgaccgcgcaccgccgaagaggtccacgcc
tccccctgggaggagctggagttcgacatcgcccgctggatcccagccttcaacatggtc
ttccgcattctgattcccagcgagcgccgcctatgcgaccgtgtcttcgacggtctcgcc
cccttcggcgacctcgcctttattgctgctgtgcgcactcaggcgctgcagctcatatca
ttcggcgacgccatttcttcctccagccgctcgccggagcgcctcttccgtgtggtggac
atgtatgaggctgtgcgggacatcctcccggaccttgaccctgtgttctccgacccttac
tccgcggcactccgcgcagaggtctctgcagtgtgcaacacccttggttcctcaatcaaa
ggtatattcatggaattggaaaatctcatccgccgggaccctgcccgggttgccacacct
ggtggtggtatacaccccatcactcggtatgtcatgaactatctccgtgctgcatgcggt
tcgcgacagacattggaagaggtgatggaaggcgaccttggtgctggtggtagagcttct
gctgccgtggaccctgaccgccccacgtcttcacttgctgtgcacatcgcatggatcatg
gacgttctgcacaagaatttggatacaaaatctaagatttaccgagatccgtcactggct
tgcatcttcttgatgaacaatggcaagtacattatccagaaagtgaatgacagcgagcta
ggtgttctactcggcgatgactggatcaagcagttgtcaactagagtgcgtcgctggagc
atggattatcagcgttcaacatggggcaaggttacaactgtgctgcagattggtggttca
ggcgttggtgcactcccaaccaaggcaatgctgcagaaattgcggatgtttaatacctac
tttgaggagatctacgcagtacaatcagaatgggtggtagccgatgatcagttgcgaatg
gacgttagggcagcagtggaggattcagtgatgccagcatatgcggctttgattgccagg
ttaaaatcagctcctgaaaccgggcgtgacttgtacatcaagtacaccccagaagatgtc
gaagcacatatccagcacttgtttgaaggagcagcaaagtga
DBGET
integrated database retrieval system