Triticum aestivum (bread wheat): 123137924
Help
Entry
123137924 CDS
T07757
Name
(RefSeq) tubby-like F-box protein 5
KO
K19600
tubby and related proteins
Organism
taes
Triticum aestivum (bread wheat)
Brite
KEGG Orthology (KO) [BR:
taes00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
03037 Cilium and associated proteins [BR:
taes03037
]
123137924
04990 Domain-containing proteins not elsewhere classified [BR:
taes04990
]
123137924
Cilium and associated proteins [BR:
taes03037
]
Primary cilia and associated proteins
Other primary cilia associated proteins
123137924
Domain-containing proteins not elsewhere classified [BR:
taes04990
]
Other domain-containing proteins
Tubby family proteins
123137924
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tub
F-box-like
F-box
DUF3527
Motif
Other DBs
NCBI-GeneID:
123137924
NCBI-ProteinID:
XP_044413751
UniProt:
A0A3B6PP89
LinkDB
All DBs
Position
6B:546475885..546479281
Genome browser
AA seq
426 aa
AA seq
DB search
MSLKSIVRELKEMRDGIGSMSRRGGVSDGRAGHGRGGSRHSWPSLWPEPQPQPQRQGQEP
QQQGQWANLPPELLIDVIQRVEASEVAWPARRHVVACAAVCRSWREVTKDVVKTLEECSR
ITFPISLKQPGPRDSPVQCFVRRDRATSTYLLYLGLSPSLHGENDKLLLAARKIRRAART
SFVISLISDDFSHSSSTYVGKLKPNFLGTKFTIFDSQPPCDAAVLPNNKPSKRHSKQVSP
RLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPAACIQEGGKAPTPTGMVHSLDEQVS
TLSTSKGKEPNMEFSSTSLSADLSGPISTSEAPLLLKNKAPRWHEQLQCWCLNFRGRVTV
ASVKNFQLVASVDPSLGVPAAEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFD
TKPACE
NT seq
1281 nt
NT seq
+upstream
nt +downstream
nt
atgtctttgaagagcatcgtgcgggagctcaaggagatgagggacggcatcgggagcatg
tccaggcgcggcggcgtctccgacgggcgcgccggccacggccgcggggggtcgcggcat
tcttggcccagcctgtggccggagccacagccgcagccgcagcggcagggccaggagccg
cagcagcaggggcagtgggcgaacctgccgccggagctgctgatcgacgtgatacagagg
gtggaggccagcgaggtggcctggccggcgcggcgccatgtcgttgcctgcgccgccgtc
tgccggtcgtggcgcgaggtcaccaaggatgtggtgaagactctcgaggagtgcagcagg
atcaccttccccatctctctaaagcagccggggcctcgtgattctccggtgcagtgtttt
gtgaggagggacagggcgacgtccacctatctcctctacttggggctcagcccatctctg
catggggaaaatgacaagcttttgcttgcggcccgcaagatcagacgtgcagccagaact
tcttttgtgatatcgctcatctctgatgatttttctcattcgagcagcacctatgttggc
aaactgaaaccaaacttccttggcacaaagttcacaatatttgatagccaacctccttgt
gatgctgcggtgttgcctaacaacaagccaagcaaaaggcactcgaagcaagtatcacca
agactgccactaggtaattacaatgttgctaccgtctcatatgagctcactgtcctgcgc
aatcgaggaccaaggagaatgcagtgcaccatgcactcaataccagccgcgtgcattcag
gaaggcggcaaggccccgacccctactggcatggtccactcacttgacgaacaagtgtcc
accttatcaactagcaaaggaaaggaaccaaacatggaattctcgtcaacaagcctcagc
gctgatttatccggaccgatctccaccagcgaagcgcctctgcttctgaagaataaagct
cctcgctggcacgagcagctgcagtgctggtgcctcaacttccgagggcgtgtcaccgta
gcatcggtcaagaacttccagctcgtcgcctcggtcgacccttccctcggcgtgcccgcg
gcagagcaggagaaggtgatcctccagttcgggaagatcgggaaagacatattcacaatg
gattatagatacccactgtcggcgttccaggcctttgcgatctgcctgactagcttcgac
acgaaaccggcctgcgaatag
DBGET
integrated database retrieval system