Triticum aestivum (bread wheat): 123139099 Help Entry 123139099         CDS       T07757                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism taes  Triticum aestivum (bread wheat) Pathway taes04145   Phagosome taes04148   Efferocytosis taes04620   Toll-like receptor signaling pathway taes05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:taes00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123139099    04148 Efferocytosis     123139099  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123139099  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123139099  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     123139099   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:taes04147]     123139099    04031 GTP-binding proteins [BR:taes04031]     123139099 Membrane trafficking [BR:taes04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     123139099  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     123139099   Macropinocytosis    Ras GTPases     123139099  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     123139099 Exosome [BR:taes04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123139099   Exosomal proteins of other body fluids (saliva and urine)    123139099   Exosomal proteins of colorectal cancer cells    123139099   Exosomal proteins of bladder cancer cells    123139099 GTP-binding proteins [BR:taes04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     123139099 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  123139099 NCBI-ProteinID:  XP_044414839 UniProt:  A0A3B5Z199 LinkDB All DBs Position 1B:complement(570928766..570932158) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVTKKWIPELRHYAPGVPIILVGTKL DLRDDEQFFVDHPGAVPISTAQGEELKKVIGATAYIECSSKTQQNIKAVFDAAIKVVLQP PKQKRKKRKSQKGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcttctcggttcatcaagtgcgtgacggtgggggacggcgccgtcggcaagact tgcctcctcatctcctacacatccaacaccttccccaccgactatgtcccaacagtcttc gacaacttcagcgctaacgtcgtggttgacgggagcaccgtcaacctcggattatgggat actgcaggacaagaggactataatagactacgcccactaagctaccgaggtgccgatgtc ttcctgctcgccttttctcttatcagcaaagcaagctacgagaatgtcactaagaagtgg atccctgagctacggcactacgctccgggtgtgcccataattcttgttgggacaaagctt gatctgcgggatgacgagcagtttttcgtggatcaccctggggctgttcctatttccaca gctcagggtgaagagctgaagaaggtaattggcgcgacggcctacatcgagtgcagctca aaaacacagcagaatatcaaggcggtgtttgatgcggcgatcaaggtggttctccagcct ccgaagcagaagcggaagaagaggaagtcgcagaaaggatgcagcatcttgtaa

DBGET integrated database retrieval system