KEGG   Triticum aestivum (bread wheat): 123142075
Entry
123142075         CDS       T07757                                 
Name
(RefSeq) mitochondrial import inner membrane translocase subunit TIM17-2-like
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
taes  Triticum aestivum (bread wheat)
Brite
KEGG Orthology (KO) [BR:taes00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:taes03029]
    123142075
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:taes02000]
    123142075
Mitochondrial biogenesis [BR:taes03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    123142075
Transporters [BR:taes02000]
 Other transporters
  Primary active transporters [TC:3]
   123142075
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 123142075
NCBI-ProteinID: XP_044417032
LinkDB
Position
6D:470029757..470030508
AA seq 163 aa
MDTTTPTTEKMPSPSLIERVRRHAISGGILGSAVYFSQGATKSPSGSRLFGGALAVPRNV
LRIGSFAAWYGAAKSVRCAVAPDYPFETTVAWGATNALFAMRHGRRAACRSGLRGAALGV
VADMAQYGVKRFLASRRSRAEERRIARESAACPAGIPADTCHA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggacaccacaacaccgacgaccgagaagatgccgtcgcctagcctcatcgaacgggtc
cgccgtcacgcaatctccggcggcatcttaggctccgccgtgtacttctcccagggcgcc
accaagtcgccgagcgggagccgcctcttcggcggggctctggcggtcccgaggaacgtg
ctcaggatcggcagctttgcggcctggtatggcgccgccaagtcggtcaggtgcgccgtg
gccccagactacccctttgaaaccacggtcgcctggggcgccaccaacgccctattcgcc
atgcgccacgggaggcgcgcggcctgccgatccgggctcagaggtgcggccctaggcgtg
gtcgccgacatggcccagtatggcgtaaaacgcttccttgcctcacggcggtcacgggca
gaggagcgccgcatagcccgtgagtcggctgcttgcccggctgggattcccgccgacaca
tgtcatgcttga

DBGET integrated database retrieval system