Triticum aestivum (bread wheat): 123143005 Help Entry 123143005         CDS       T07757                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism taes  Triticum aestivum (bread wheat) Pathway taes03083   Polycomb repressive complex taes04120   Ubiquitin mediated proteolysis taes04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:taes00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123143005    04120 Ubiquitin mediated proteolysis     123143005   09126 Chromosome    03083 Polycomb repressive complex     123143005  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     123143005    04121 Ubiquitin system [BR:taes04121]     123143005    03036 Chromosome and associated proteins [BR:taes03036]     123143005 Membrane trafficking [BR:taes04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     123143005 Ubiquitin system [BR:taes04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      123143005    Cul7 complex      123143005 Chromosome and associated proteins [BR:taes03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      123143005   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      123143005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  123143005 NCBI-ProteinID:  XP_044417682 LinkDB All DBs Position 6D:9074146..9075520 Genome browser AA seq 156 aa AA seqDB search MATAEAGENKMIMLISSDGMEFEVEEAIAMESQTIRQMIEDECAGKGIPIPNINSKILSR VIEYCNKHVPTMPTTGATGAATSDTVAPAALAEDLKIWDREFIKVNRATLLDLNQAASYL NIKGLLDLTCQTTDTISGHNLEELRSFLQHQERLLA NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcgaccgcagaggcaggtgagaacaagatgatcatgctcatatcgtctgacggcatg gagttcgaggtagaggaggcaatcgccatggagtcgcagaccatccgccaaatgatcgag gatgagtgcgccggcaaaggcattccgatccccaacatcaactccaagatcctctccagg gtcatcgagtactgcaacaaacacgtcccgaccatgccaaccactggagccaccggtgcc gccacgtctgacaccgtggctcccgccgccctagccgaggacctcaagatctgggacaga gaattcatcaaggtcaaccgtgccaccctcttagatctcaaccaggctgcaagttacctc aacatcaaggggttgttggacctgacttgccagactaccgacacgattagtggccataat ctggaggagctccgtagtttccttcagcatcaagaacgactacttgcctga

DBGET integrated database retrieval system