Triticum aestivum (bread wheat): 123143403 Help Entry 123143403         CDS       T07757                                  Name (RefSeq) rac-like GTP-binding protein 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism taes  Triticum aestivum (bread wheat) Pathway taes04145   Phagosome taes04148   Efferocytosis taes04517   IgSF CAM signaling taes04518   Integrin signaling taes04519   Cadherin signaling taes04620   Toll-like receptor signaling pathway taes05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:taes00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     123143403    04518 Integrin signaling     123143403    04519 Cadherin signaling     123143403  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123143403    04148 Efferocytosis     123143403  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123143403  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123143403  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     123143403   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:taes04147]     123143403    04031 GTP-binding proteins [BR:taes04031]     123143403 Membrane trafficking [BR:taes04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     123143403  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     123143403   Macropinocytosis    Ras GTPases     123143403  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     123143403 Exosome [BR:taes04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123143403   Exosomal proteins of other body fluids (saliva and urine)    123143403   Exosomal proteins of colorectal cancer cells    123143403   Exosomal proteins of bladder cancer cells    123143403 GTP-binding proteins [BR:taes04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     123143403 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  123143403 NCBI-ProteinID:  XP_044418255 UniProt:  A0A0C4BK50 LinkDB All DBs Position 6D:<44195393..44198708 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELKKLIGAPYYIECSSKTQLNVKGVFDAAIKVVLAP PKAKKKKKAQRGACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtccaggttcataaagtgcgtcaccgtgggggacggcgccgtcggcaagact tgcatgctcatctcctacacctccaacaccttccccaccgactatgtgccaacggtgttt gacaacttcagtgctaatgttgtggttgatggcaacactgtcaacctcgggctatgggat actgcaggtcaggaggactacaacagactgagaccgctgagttatcgtggagctgatgtc ttccttctggccttctcgcttatcagcaaggccagctatgagaatgtttcaaagaagtgg atacctgagctgaagcattatgcaccaggtgtgcctattatccttgtgggaacaaagctt gatcttcgagatgacaagcagttctttgtggaccatcctggtgctgttcctatcactact gctcagggggaggaactaaaaaagttaataggcgcaccctactacatcgaatgcagctca aagacccaactaaatgtcaagggtgtatttgatgcggcaataaaggtggtacttgcgcca ccaaaggcaaagaagaagaaaaaggcgcagaggggggcttgctccatcttgtga

DBGET integrated database retrieval system