Triticum aestivum (bread wheat): 123145512 Help Entry 123145512         CDS       T07757                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism taes  Triticum aestivum (bread wheat) Pathway taes04145   Phagosome taes04148   Efferocytosis taes04517   IgSF CAM signaling taes04518   Integrin signaling taes04620   Toll-like receptor signaling pathway taes05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:taes00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     123145512    04518 Integrin signaling     123145512  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123145512    04148 Efferocytosis     123145512  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123145512  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123145512  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     123145512   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:taes04147]     123145512    04031 GTP-binding proteins [BR:taes04031]     123145512 Membrane trafficking [BR:taes04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     123145512  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     123145512   Macropinocytosis    Ras GTPases     123145512  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     123145512 Exosome [BR:taes04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123145512   Exosomal proteins of other body fluids (saliva and urine)    123145512   Exosomal proteins of colorectal cancer cells    123145512   Exosomal proteins of bladder cancer cells    123145512 GTP-binding proteins [BR:taes04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     123145512 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C Motif Other DBs NCBI-GeneID:  123145512 NCBI-ProteinID:  XP_044420873 UniProt:  A0A3B6QL46 LinkDB All DBs Position 6D:419528755..419532019 Genome browser AA seq 213 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVADGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPVVLVGT KLDLREDKHYLLDHPGMIPVTTAQGEELRKQVGALYYIECSSKTQQNVKAVFDAAIKVVI QPPTKQREKKKKKQRRGCSMMNFGGRKMLCFKS NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atggcgtccagcgcttcccggttcatcaagtgcgtcacggtgggcgacggcgccgtgggc aagacctgcatgctcatctgctacaccagcaacaagttccccaccgactacatacccacg gtgttcgacaatttcagcgcaaacgtggtagcggacggcaccacggtgaatttgggcctt tgggataccgccgggcaggaggattacaaccggctgaggcctctgagctaccgcggcgct gacgtttttgtgcttgccttctctcttgtgagccgagctagctatgagaacatcatgaag aagtggataccggagcttcagcattacgcgcccggcgtgccggttgtgctggtaggcaca aaactggatcttcgtgaagacaagcactatttgctggaccaccctggcatgatacccgtt accacagcacagggggaggaacttcgtaagcaagtcggtgctttatattacatagagtgc agctcaaagacacaacagaatgtcaaagctgtgtttgatgctgctatcaaggtagtaatc cagcccccaactaaacaaagagaaaagaagaaaaagaagcagcgtcgtggatgctctatg atgaacttcggtggaaggaaaatgctatgcttcaaatcctga

DBGET integrated database retrieval system