Triticum aestivum (bread wheat): 123145724 Help Entry 123145724         CDS       T07757                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism taes  Triticum aestivum (bread wheat) Pathway taes04136   Autophagy - other Brite KEGG Orthology (KO) [BR:taes00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     123145724  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     123145724    04121 Ubiquitin system [BR:taes04121]     123145724    03029 Mitochondrial biogenesis [BR:taes03029]     123145724 Membrane trafficking [BR:taes04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     123145724 Ubiquitin system [BR:taes04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    123145724 Mitochondrial biogenesis [BR:taes03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     123145724 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  123145724 NCBI-ProteinID:  XP_044421132 LinkDB All DBs Position 6D:complement(445266414..445270061) Genome browser AA seq 97 aa AA seqDB search MAGSDDDQKVVVCLRSLGSAPMLRRNKFKISGREKFSKIIEFLRGQLQKDTLFVYVHSAF SLNPFSPKPDELLIDLYNNFAMDGNLVVSYAFWAPWG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggccggctccgacgatgatcagaaagtcgtggtgtgcttacgctcgctcggcagcgcg ccgatgctgaggcgaaacaagttcaagatttcgggacgagagaaattctcgaagattatc gaatttcttcgcggacaacttcagaaggatacgctgtttgtctatgtccacagtgcattt tcactaaacccattttcaccaaaaccagacgagctgctaatcgacttatataataatttt gctatggacggaaatcttgtggtatcttatgctttttgggcaccgtggggttaa

DBGET integrated database retrieval system