Triticum aestivum (bread wheat): 123147364 Help Entry 123147364         CDS       T07757                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism taes  Triticum aestivum (bread wheat) Pathway taes03018   RNA degradation taes03040   Spliceosome Brite KEGG Orthology (KO) [BR:taes00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     123147364   09123 Folding, sorting and degradation    03018 RNA degradation     123147364  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:taes03019]     123147364    03041 Spliceosome [BR:taes03041]     123147364 Messenger RNA biogenesis [BR:taes03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      123147364   mRNA degradation factors    5'-3' decay     Lsm complex      123147364 Spliceosome [BR:taes03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     123147364  Complex C   U2 snRNP components     123147364 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX LSM14 DUF1256 DUF150_C Motif Other DBs NCBI-GeneID:  123147364 NCBI-ProteinID:  XP_044422538 LinkDB All DBs Position 7A:complement(427083947..427089744) Genome browser AA seq 93 aa AA seqDB search MLFFSYFKELVGKEVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVLLPQDGVDIDILHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctgttcttctcctacttcaaggagctcgtcgggaaggaggttacggtcgagctcaag aacgacctggccatccgcggcacgctccactcggtggatcagtacctcaacatcaagctc gagaacactcgggtcgtcgaccaggacaagtatccccacatgctatcggtgcggaactgc ttcatcaggggatctgtggtgcgttacgtcctgcttccgcaggacggggttgacatcgac atcctccatgatgccaccaggagggaggcacggggcggctga

DBGET integrated database retrieval system