KEGG   Triticum aestivum (bread wheat): 123156451
Entry
123156451         CDS       T07757                                 
Name
(RefSeq) SKP1-like protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
taes  Triticum aestivum (bread wheat)
Pathway
taes03083  Polycomb repressive complex
taes04120  Ubiquitin mediated proteolysis
taes04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:taes00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    123156451
   04120 Ubiquitin mediated proteolysis
    123156451
  09126 Chromosome
   03083 Polycomb repressive complex
    123156451
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:taes04131]
    123156451
   04121 Ubiquitin system [BR:taes04121]
    123156451
   03036 Chromosome and associated proteins [BR:taes03036]
    123156451
Membrane trafficking [BR:taes04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    123156451
Ubiquitin system [BR:taes04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     123156451
   Cul7 complex
     123156451
Chromosome and associated proteins [BR:taes03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     123156451
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     123156451
SSDB
Motif
Pfam: Skp1_POZ Skp1 LTI65_PGEED
Other DBs
NCBI-GeneID: 123156451
NCBI-ProteinID: XP_044430515
UniProt: A0A3B6SUL9
LinkDB
Position
7B:complement(762513943..762516396)
AA seq 176 aa
MAAAEGKKKIIKLKSSDGKEFEVEQAVAMESQMIRHMIEDDYTDKGLLLCNVNSKILSKV
IEYCNKHVQAKAVDTSDFGGGARPLDATSAVPAAPAEDLKNWDANFVKVDTATIFDLALA
ANHLNIRGLLDLTCQTVADMITGKTPEEIRKIFNINEKLRPEEEEKIRRENQWAFE
NT seq 531 nt   +upstreamnt  +downstreamnt
atggcggccgcagagggcaagaagaagatcatcaagctcaagagttcagacggtaaggag
tttgaggtggagcaggcggtggccatggagtcgcaaatgatccggcacatgatcgaggac
gactatactgacaaaggcttgttgctctgcaatgtcaactcaaagatcctctccaaggtc
attgagtactgcaacaaacacgtccaagcaaaggccgtcgacacatctgattttggtgga
ggagctaggccgttagatgctacatcggctgtgcctgcggcgcccgcagaggacctcaaa
aactgggacgccaatttcgtcaaggtcgacacggccaccatattcgacctcgcactggct
gcgaaccacctcaacatcagggggctcctagacttgacttgccagaccgtcgccgacatg
atcacgggaaagacgccagaggagatccgcaagatcttcaacatcaatgagaaattaaga
cccgaggaggaggagaagatccgcagggaaaaccagtgggcctttgagtag

DBGET integrated database retrieval system