Triticum aestivum (bread wheat): 123166866 Help Entry 123166866         CDS       T07757                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism taes  Triticum aestivum (bread wheat) Pathway taes03083   Polycomb repressive complex taes04120   Ubiquitin mediated proteolysis taes04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:taes00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123166866    04120 Ubiquitin mediated proteolysis     123166866   09126 Chromosome    03083 Polycomb repressive complex     123166866  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:taes04131]     123166866    04121 Ubiquitin system [BR:taes04121]     123166866    03036 Chromosome and associated proteins [BR:taes03036]     123166866 Membrane trafficking [BR:taes04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     123166866 Ubiquitin system [BR:taes04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      123166866    Cul7 complex      123166866 Chromosome and associated proteins [BR:taes03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      123166866   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      123166866 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ DarP Motif Other DBs NCBI-GeneID:  123166866 NCBI-ProteinID:  XP_044440610 LinkDB All DBs Position 7D:complement(642118932..642121382) Genome browser AA seq 143 aa AA seqDB search MESQMIRHMIEDDYTDNGLLLRNVNSKILSKVIEYYNKHVQAKATNTSDFGGGARASDAT SAVPAALAEDLKNWDANFIKVDKDTIFDLMLAANHLNIKGLLDLTCQTVADMMTGKTPEE IRKIFNINEKLKPEEEEEIRREN NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggagtcgcaaatgatccggcacatgatcgaggatgactatactgacaacggcttgttg ctccgcaatgtcaactcaaagatcctctccaaggtcattgagtactacaacaaacacgtc caagcaaaggccaccaacacatctgattttggaggaggagctagggcgtcagatgctaca tcggctgtgcctgcggcgctcgcggaggacctcaaaaactgggacgccaatttcatcaag gtcgataaggacaccatattcgacctcatgctggctgcaaaccacctcaacatcaagggg ctcctagacctgacttgccagaccgtcgctgacatgatgacgggaaagacgccagaggag atccgcaagatcttcaacatcaatgagaaattaaaacctgaggaggaggaggagatccgc agggagaactag

DBGET integrated database retrieval system