Triticum aestivum (bread wheat): 123179833 Help Entry 123179833         CDS       T07757                                  Name (RefSeq) glutathione S-transferase 1-like   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism taes  Triticum aestivum (bread wheat) Pathway taes00480   Glutathione metabolism taes01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:taes00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     123179833  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:taes02000]     123179833 Enzymes [BR:taes01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      123179833 Transporters [BR:taes02000]  Other transporters   Pores ion channels [TC:1]    123179833 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_C_3 GST_C_2 GST_C_7 Motif Other DBs NCBI-GeneID:  123179833 NCBI-ProteinID:  XP_044447661 LinkDB All DBs Position 1D:7195413..7196366 Genome browser AA seq 124 aa AA seqDB search MVDVWMEVEAHHYSPIMDAILMEIRIRPIFGQRVDESAVEGNIEKLKKVLEVYQSRLSSS RYLAGDFISLADLNHVSTMLCLGVTTYRSVLDAYPRVRAWWDGLRARPAVRKVSGLMNPS AKNF NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggtggacgtgtggatggaggtggaggctcaccattacagccctataatggatgctatc ctcatggaaatcaggatccggccgatctttgggcaaagagtagacgagagcgccgtggag ggcaacatcgagaagctaaagaaggtgctggaggtgtaccagtcgaggctgtcgagctcc aggtacctggctggtgatttcatcagcctcgcggacctcaaccatgtgtccaccatgttg tgcctaggggtcactacatacaggtcagttctcgacgcgtacccacgtgtgagggcatgg tgggatggcctgagggccaggccggcggtgaggaaggtgtctggtctaatgaatccgtcc gcgaagaatttctga

DBGET integrated database retrieval system