Thermosipho africanus: THA_1568 Help Entry THA_1568          CDS       T00797                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism taf  Thermosipho africanus Pathway taf00030   Pentose phosphate pathway taf00051   Fructose and mannose metabolism taf00710   Carbon fixation by Calvin cycle taf01100   Metabolic pathways taf01110   Biosynthesis of secondary metabolites taf01120   Microbial metabolism in diverse environments taf01200   Carbon metabolism taf01230   Biosynthesis of amino acids Module taf_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:taf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     THA_1568 (rpiB)    00051 Fructose and mannose metabolism     THA_1568 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     THA_1568 (rpiB) Enzymes [BR:taf01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      THA_1568 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Gly_rich_SFCGS PGM_PMM_I DUF5615 MotA_N Tnp_DNA_bind DUF7375 Motif Other DBs NCBI-ProteinID:  ACJ76006 UniProt:  B7IDC9 LinkDB All DBs Position complement(1572649..1573086) Genome browser AA seq 145 aa AA seqDB search MKIAIGSDHAGFELKNKLVDYLSKKGIEIIDVGTNSTESVDYPDYAKEVGKLVVNKDADF GILICGTGIGMSIAANKIKGIRAALCMIPEMGKLARNHNNANILVLPGRLIGFELATWIV EEFLNADFEGGRHERRINKIVELEK NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgaaaattgcaataggttcggatcacgcaggttttgagctaaaaaataaacttgtagat tatttatctaaaaaaggaattgagattatagatgtaggaacaaatagtaccgaaagtgta gattatcctgattatgcaaaagaagttggaaaacttgttgtaaataaagatgctgatttt ggaatactcatatgtggtacaggcattggaatgtcaattgctgcaaacaaaattaaggga ataagagcagctctctgtatgatacctgaaatgggaaaacttgcaagaaatcataataat gcaaacatattggtccttcctggaagattaataggatttgaacttgcaacatggattgtg gaagaatttttgaatgcagattttgaaggtggaagacacgaaagaagaataaataaaata gtagaacttgaaaagtaa

DBGET integrated database retrieval system