Thermosipho africanus: THA_1870 Help Entry THA_1870          CDS       T00797                                  Symbol acpP2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism taf  Thermosipho africanus Pathway taf01100   Metabolic pathways taf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:taf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     THA_1870 (acpP2)    00074 Mycolic acid biosynthesis     THA_1870 (acpP2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     THA_1870 (acpP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Band_7_1 Motif Other DBs NCBI-ProteinID:  ACJ76296 UniProt:  B7IE69 LinkDB All DBs Position complement(1875333..1875587) Genome browser AA seq 84 aa AA seqDB search MERAELFRQVSKILAEKLNIPIEDIDESSNIIDDLGADSLDVVDLVMILEDEYGIRIEDD ELENISTVEDVINIIESKLKVQGD NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggaaagagcagaattatttagacaagtaagtaaaatattagccgaaaaattgaacatt ccaattgaagatattgatgaaagttccaatattattgatgatttgggagcagattcattg gatgtagtagatttagtaatgattctcgaagacgaatatggaattagaattgaagacgat gaactagaaaatatatctacagttgaagatgtaatcaacataattgaatccaaattaaag gttcaaggagattaa

DBGET integrated database retrieval system