Thermosipho africanus: THA_337 Help Entry THA_337           CDS       T00797                                  Name (GenBank) conserved domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism taf  Thermosipho africanus Pathway taf00020   Citrate cycle (TCA cycle) taf00720   Other carbon fixation pathways taf01100   Metabolic pathways taf01110   Biosynthesis of secondary metabolites taf01120   Microbial metabolism in diverse environments taf01200   Carbon metabolism taf01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:taf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     THA_337   09102 Energy metabolism    00720 Other carbon fixation pathways     THA_337 Enzymes [BR:taf01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      THA_337 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_21 Fer4_10 Fer4_6 Fer4_9 Fer4_4 Fer4_16 Fer4_15 Fer4_8 Fer4_13 Fer4_3 Fer4_22 Fer4_17 Fer4_18 Motif Other DBs NCBI-ProteinID:  ACJ74837 UniProt:  B7IFH3 LinkDB All DBs Position complement(340827..341048) Genome browser AA seq 73 aa AA seqDB search MPKVKGYIEIDQERCKGCGLCINACPMKVIEFSDSFNSKGYHPAEPKHLEKCIACGFCYR MCPDVCITVYREE NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcctaaggtaaaaggatatattgaaatcgatcaggaaagatgtaaaggttgcggatta tgtattaatgcttgtccaatgaaagttatagaattttctgattctttcaattcaaaaggt tatcatcctgccgaaccaaaacatttagaaaaatgtatcgcatgtggattttgttataga atgtgccctgatgtttgtataacagtatatagggaagagtga

DBGET integrated database retrieval system