Thermosphaera aggregans: Tagg_0937 Help Entry Tagg_0937         CDS       T01237                                  Name (GenBank) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism tag  Thermosphaera aggregans Pathway tag03060   Protein export tag04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tag00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Tagg_0937    04141 Protein processing in endoplasmic reticulum     Tagg_0937  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Tagg_0937  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tag04131]     Tagg_0937   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tag02044]     Tagg_0937 Membrane trafficking [BR:tag04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     Tagg_0937 Secretion system [BR:tag02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    Tagg_0937 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-ProteinID:  ADG91209 UniProt:  D5U259 LinkDB All DBs Position 881278..881460 Genome browser AA seq 60 aa AA seqDB search MNLRELVEAWRKIILLATKPSRDDYMTSLKLSLLGLALVGGIAFVIRILFYTFLFPPPAG NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgaacctgagggaactggttgaggcttggaggaagataatcttgcttgctactaagccg agcagggatgactacatgacgtctttaaagctcagcctcttggggctggccttggtaggg ggcatagctttcgtgataaggattttattctacacttttctattcccccctccagctggg tga

DBGET integrated database retrieval system