Thermosphaera aggregans: Tagg_1371 Help Entry Tagg_1371         CDS       T01237                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tag  Thermosphaera aggregans Pathway tag03010   Ribosome Brite KEGG Orthology (KO) [BR:tag00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Tagg_1371   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Tagg_1371  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tag03011]     Tagg_1371    04121 Ubiquitin system [BR:tag04121]     Tagg_1371   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tag04147]     Tagg_1371 Ribosome [BR:tag03011]  Ribosomal proteins   Eukaryotes    Small subunit     Tagg_1371   Archaea     Tagg_1371 Ubiquitin system [BR:tag04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Tagg_1371 Exosome [BR:tag04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Tagg_1371   Exosomal proteins of colorectal cancer cells    Tagg_1371 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Zn_ribbon_IS1595 Zn_ribbon_RPB9 TackOD1 Zn_ribbon_Nudix Phage_zn_bind_2 Zn_ribbon_3 Zn_Ribbon_1 Ribosomal_L37ae DZR Lar_restr_allev zf_UBZ DUF7479 A2L_zn_ribbon Zn_ribbon_recom DUF1451 YhfH DUF6758 Motif Other DBs NCBI-ProteinID:  ADG91631 UniProt:  D5U3D1 LinkDB All DBs Position complement(1284785..1284946) Genome browser AA seq 53 aa AA seqDB search MPYVHKLYEVDYKTGKLVRKNKTCPKCGSFMAFHEQPVPRWHCGRCGYVEYAK NT seq 162 nt NT seq  +upstreamnt  +downstreamnt atgccctatgttcacaaactatacgaggtggattataagacggggaagctggtgaggaag aataagacgtgccctaagtgcggctccttcatggctttccacgagcaaccagtccctaga tggcactgcgggagatgcggatacgtcgagtacgcgaagtag

DBGET integrated database retrieval system