Thermococcus aggregans: NF865_00680 Help Entry NF865_00680       CDS       T10933                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tagg  Thermococcus aggregans Pathway tagg03010   Ribosome Brite KEGG Orthology (KO) [BR:tagg00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NF865_00680   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NF865_00680  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tagg03011]     NF865_00680    04121 Ubiquitin system [BR:tagg04121]     NF865_00680 Ribosome [BR:tagg03011]  Ribosomal proteins   Eukaryotes    Large subunit     NF865_00680   Archaea     NF865_00680 Ubiquitin system [BR:tagg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NF865_00680 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 Zn_ribbon_RPAB4 DZR DZR_2 Toxin_5 Zn_ribbon_10 HVO_0416 Zn_ribbon_3 Zn_ribbon_GTF2H2 Motif Other DBs NCBI-ProteinID:  USS41756 UniProt:  A0A9E7SQF7 LinkDB All DBs Position complement(114198..114356) Genome browser AA seq 52 aa AA seqDB search MARFPEAEARIFRKYICMRCGATNPWKAEKCRKCGYKGLRPKAKEPRGGAGR NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggcgaggttccctgaagcagaggcaagaatatttaggaagtatatatgtatgaggtgc ggtgctaccaacccatggaaagcagagaagtgcagaaagtgcggatacaagggattgagg ccaaaagctaaggagccaagaggaggagcaggacgttag

DBGET integrated database retrieval system